KEGG   Anolis carolinensis (green anole): 100552382Help
Entry
100552382         CDS       T01608                                 

Definition
steroid 21-hydroxylase-like
Orthology
K00513  
steroid 21-monooxygenase [EC:1.14.99.10]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100552382
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.10  steroid 21-monooxygenase
     100552382
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP21 family
   100552382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 468 aa AA seqDB search
MLSALLFVVVLLAIALLSRWHPWHCQGKDAKDLPGPRALPLIGNLSHMFQPNLPIHFLQL
AHRYGPIYRLRLGNKANLISMGGKDLSLGDYTPTWRLQRKLTHMAFQRCRQGDMEQIVHS
QAQHLCKVFRSYGGEPVDVAHDFSMHACSVISTMLFGPLDMPSIEKMHDCMLEMVKAWNA
LPIRVLDFWPILKIFPNPSLRHLLSCLENRDDVVQGQMAKHQKSDHSPEEQDMLDHMLHF
LHDHDIKKWGDTGLLPDHVHMAVVDLVTGGTETTATLLTWAVAFLLHCPQIQELIHKELM
TVVGPHRDPTYSDREHLPYLNATIWEALRMRPSAPLALPHMTIRDTSVAGFSIPKGTTVI
PNLYGAHQDPSKWPNPQEFRPERFLEGQALAEAQRHLVPFSCGARVCLGEALARMEAFLF
LAYILRDFQILPSPSGSLPDLQPHCEFLMFCKPFMARLVPWVENGSAE
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgctcttctcttcgttgtcgtcctcctggctattgccctgttgagccggtgg
catccgtggcactgccagggcaaagatgcgaaggatctgcccggcccaagagctttgccc
ctcattggaaacctctcccatatgttccagccaaacctccccatccatttcctccagctg
gcccatcggtacggacccatctaccgcctgcgcctcgggaacaaagcaaacctgatttca
atgggcgggaaggacctctccctgggcgactacaccccaacgtggcgtctgcaacggaag
ctgacccacatggccttccagcgctgccgacaaggagacatggagcagattgtgcacagc
caagctcaacacctctgcaaggtttttcgtagctatggcggggaacctgtggatgtggct
catgatttttctatgcacgcctgttctgttatttctaccatgctctttggacctttggac
atgcccagcattgaaaaaatgcatgactgcatgctcgaaatggtaaaagcatggaatgct
cttcccatccgggttctggatttctggccaatcctcaaaatttttcctaacccctcattg
aggcacctcctttcctgccttgaaaaccgagacgatgtggtccaaggccagatggcgaaa
caccagaagtctgaccattcaccagaggaacaagacatgttggaccatatgctgcacttc
cttcatgaccatgacatcaagaagtggggcgacacgggactcctccctgaccatgtccac
atggctgttgttgacctggtcactggaggtaccgaaacgacagctaccttactgacctgg
gctgtggcctttctgctgcattgtccacagattcaggagctaatccacaaggagttaatg
acagtagtaggaccacaccgtgaccctacttatagtgaccgggagcatctgccctacctc
aacgccaccatctgggaagcactgcgcatgcgcccctccgcaccccttgctttgcctcac
atgaccattcgggataccagcgtggctggtttttccatccccaaaggcacaactgtcatc
cccaatctctacggcgcccaccaggatccaagcaaatggccaaatcctcaggagttcaga
ccagagaggttcctggaaggacaagccttggccgaagcccagcggcacttggtacccttt
agctgtggggcccgggtctgcttaggagaagccttggctcggatggaggccttcctcttc
ctcgcttacatactgcgggatttccagattttgccttcaccgtctgggtcgctgccagac
ctccagccacattgtgagttcctcatgttttgcaagccgttcatggcacggctagtgccg
tgggtggagaacgggtctgcagaatga

DBGET integrated database retrieval system