KEGG   Anolis carolinensis (green anole): 100552382Help
Entry
100552382         CDS       T01608                                 

Definition
(RefSeq) steroid 21-hydroxylase
  KO
K00513  
steroid 21-monooxygenase [EC:1.14.14.16]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Steroid hormone biosynthesis
Metabolic pathways
Module
C21-Steroid hormone biosynthesis, progesterone => cortisol/cortisone
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100552382
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.16  steroid 21-monooxygenase
     100552382
Cytochrome P450 [BR:acs00199]
 Cytochrome P450, animal type
  CYP21 family
   100552382
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 498 aa AA seqDB search
MLSALLFVVVLLAIALLSRWHPWHCQGKDAKDLPGPRALPLIGNLSHMFQPNLPIHFLQL
AHRYGPIYRLRLGNKDVVVLNSLETIREALIRKWSDFAGRPHSFITNLISMGGKDLSLGD
YTPTWRLQRKLTHMAFQRCRQGDMEQIVHSQAQHLCKVFRSYGGEPVDVAHDFSMHACSV
ISTMLFGPLDMPSIEKMHDCMLEMVKAWNALPIRVLDFWPILKIFPNPSLRHLLSCLENR
DDVVQGQMAKHQKSDHSPEEQDMLDHMLHFLHDHDIKKWGDTGLLPDHVHMAVVDLVTGG
TETTATLLTWAVAFLLHCPQIQELIHKELMTVVGPHRDPTYSDREHLPYLNATIWEALRM
RPSAPLALPHMTIRDTSVAGFSIPKGTTVIPNLYGAHQDPSKWPNPQEFRPERFLEGQAL
AEAQRHLVPFSCGARVCLGEALARMEAFLFLAYILRDFQILPSPSGSLPDLQPHCEFLMF
CKPFMARLVPWVENGSAE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgctctctgctcttctcttcgttgtcgtcctcctggctattgccctgttgagccggtgg
catccgtggcactgccagggcaaagatgcgaaggatctgcccggcccaagagctttgccc
ctcattggaaacctctcccatatgttccagccaaacctccccatccatttcctccagctg
gcccatcggtacggacccatctaccgcctgcgcctcgggaacaaagacgttgtcgtgctg
aacagcttagaaacgatccgggaggcgctgattcggaagtggtctgacttcgcgggacgg
cctcacagctttattacaaacctgatttcaatgggcgggaaggacctctccctgggcgac
tacaccccaacgtggcgtctgcaacggaagctgacccacatggccttccagcgctgccga
caaggagacatggagcagattgtgcacagccaagctcaacacctctgcaaggtttttcgt
agctatggcggggaacctgtggatgtggctcatgatttttctatgcacgcctgttctgtt
atttctaccatgctctttggacctttggacatgcccagcattgaaaaaatgcatgactgc
atgctcgaaatggtaaaagcatggaatgctcttcccatccgggttctggatttctggcca
atcctcaaaatttttcctaacccctcattgaggcacctcctttcctgccttgaaaaccga
gacgatgtggtccaaggccagatggcgaaacaccagaagtctgaccattcaccagaggaa
caagacatgttggaccatatgctgcacttccttcatgaccatgacatcaagaagtggggc
gacacgggactcctccctgaccatgtccacatggctgttgttgacctggtcactggaggt
accgaaacgacagctaccttactgacctgggctgtggcctttctgctgcattgtccacag
attcaggagctaatccacaaggagttaatgacagtagtaggaccacaccgtgaccctact
tatagtgaccgggagcatctgccctacctcaacgccaccatctgggaagcactgcgcatg
cgcccctccgcaccccttgctttgcctcacatgaccattcgggataccagcgtggctggt
ttttccatccccaaaggcacaactgtcatccccaatctctacggcgcccaccaggatcca
agcaaatggccaaatcctcaggagttcagaccagagaggttcctggaaggacaagccttg
gccgaagcccagcggcacttggtaccctttagctgtggggcccgggtctgcttaggagaa
gccttggctcggatggaggccttcctcttcctcgcttacatactgcgggatttccagatt
ttgccttcaccgtctgggtcgctgccagacctccagccacattgtgagttcctcatgttt
tgcaagccgttcatggcacggctagtgccgtgggtggagaacgggtctgcagaatga

DBGET integrated database retrieval system