KEGG   Anolis carolinensis (green anole): 100552393Help
Entry
100552393         CDS       T01608                                 

Gene name
eea1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
acs  Anolis carolinensis (green anole)
Pathway
Endocytosis
Phagosome
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100552393 (eea1)
   04145 Phagosome
    100552393 (eea1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 1448 aa AA seqDB search
MHPPPLKFDARLNMKWSPESAYAQYNHMSITSPTPKRAIDNLKKVKVFNPGRVGSQASDS
DSAVSGNAVDVNNESSSEGFICPLCMKSHGSAEELFKHYEAVHESGVDASHGSELSLKRD
DITLLRQEVQDLQASLKEERWYSEELKKELEKVQGQRHQENKPDGLAGAAPTELETLEQQ
LEESQVEKFNIKQMKDLFEQKAAQLATEIVDLKAKYDEEKSLREAAEHRLANLTEELQKE
RGVCEDLKTELLQRPGVEDVAVLKKELVQVQTLMDKMTLEREKESEKLQDECNHLQAEYT
TSQATINQLRAELAKGPQEVAVYVQELQKLQISVNELTQKNQSLLEKLKKRELDCSRLEE
KQTEESISKKNLQATLNQKDLDCQQLQARLSASEDSLQRLQKELGERREASQKLKEELSE
AETKYQHLKAEFKQLQQQREEKEQHSLQLQNELNQLHNKLLETEHQLGEAHGRLKEQRQL
SSEKLMDKEQQVADLQIKLSRSEEELKEKAANATELQHQLDKMKQQHQEQQNLQQSTTAK
LREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEGETAVL
NQLQEKNHTLQEQVTQLTEKLKNQSESHKQALENLHEQVQEQKAHLRSSQDRVVSLEATI
TELNSQLSESKEKVIQLDLQVKAKTELLLIAEAAKAAQRADLQNHLDTAQNALQDKQQEL
NKVNTQLDQVTSKLQDKQEYCTQLETNLKEYKEKHLHLEQKKEELEGQRKKLEADILEIT
ESKAKALQELQQQRQQCTDLNLKAAELTKLLDSEREIVSSIKLDLQKKCDALGESNQQIL
KQEEENARLKLDIEKLHQEADKHNKELDRKLQATTEDLKKLELEKETLLKELEAIKNKLS
KNTEYLKEAKDELEKEKQKGKTAVAEIEKSCQEARRQLQLQSESIAKEQNELKNSLEKQE
GISKQLATELEAARSQVLQIQGVLKEKEKNEQQLQLKVKELKESFDQKKKQNETQQAELK
TALLEKAELENKLQQQITLSAQELTAEREKVTELQKTYKTAQENTEKLQLDIYGKESELL
ATRQDLKSIEEKLALAQEELVSNRNQISNHNQLIKELKIVRTTLEQDVSKKEQQLKEQEK
LLQEMQKDKDLKEKDLTNEKSKIAELQKITSKQEKEHSKLKEEAKISKQEFEKEITNLKD
AKQVLIKQKLELQGKVDSLNTALEQERKNQEAIKDQLKKKEEEMKKKCAELETKLQAEIK
EKAEQCKSSKEAEGKFNMQITALNENLGTVKKEWQSSQRRVNELEKQIDDLRGEIAVLEA
TVQNNQDERRVLLERCLKSEGEIEKLQNKLMDSRRKLDDTTAAMQELGRENQSLQIKHTQ
ALNRKWAEDNEVQNCMSCGKNFSVTIRRHHCRQCGNIFCAECSSKNALTPSSKKPVRVCD
TCFIDLQG
NT seq 4347 nt NT seq  +upstreamnt  +downstreamnt
atgcatccacctccactgaagtttgatgcaagactgaatatgaaatggagtcctgagtct
gcatatgctcagtacaaccatatgtctataacttctcccacaccaaagagagcaattgat
aatctgaaaaaagtgaaagtctttaatccaggcagagttggatctcaggcctcagattct
gactctgcagtctctggaaatgcggtggatgttaacaatgagagctcttcagagggattt
atttgtccactttgtatgaaatcccatggatcggctgaagaacttttcaaacactatgaa
gcagttcatgaatctggtgtcgacgcaagtcatggaagcgaattgtctctaaaaagggat
gacataacactactgcggcaagaagttcaagacttgcaagcttcattgaaggaggagcga
tggtactctgaagagctgaagaaggaattagaaaaagttcaagggcagaggcatcaagag
aataaacctgatggactggccggtgcagcacctacagaattggaaacgttagaacagcag
ctagaagagagtcaagtagaaaagtttaatattaagcagatgaaagacttatttgaacag
aaagcagcacaacttgccacagaaattgtggatcttaaagccaaatatgatgaagaaaag
agcctccgagaagctgcagaacacagactggcaaatttgacagaggaattacagaaagaa
agaggtgtatgtgaagatttgaaaacagagctgcttcagagacctggtgtggaagatgtt
gctgttcttaagaaggaattagttcaagttcaaacacttatggacaaaatgaccttggag
cgtgagaaagaatcggagaaactgcaagatgagtgcaatcatttgcaagcagaatatacg
acctcacaggctactatcaatcagttacgagctgagcttgccaaaggacctcaagaagtt
gctgtatatgtgcaagaacttcaaaaacttcaaatttcagttaacgaattaacacagaaa
aatcagagtctgttggaaaaattgaaaaagagagaattggattgctctcggttagaagaa
aagcaaactgaggagtcaataagtaaaaagaatctgcaagcaacccttaatcaaaaagat
ttggactgtcagcagcttcaggcaaggctatctgcatctgaggactcattgcagaggttg
cagaaagaattaggtgaaaggagagaagcaagtcaaaaacttaaggaagaattgtcagaa
gcagagaccaaataccagcatcttaaggcagagtttaaacagttacaacaacaaagggag
gaaaaagaacagcatagcctacaacttcaaaatgaactcaatcagttacataataaactt
ctggagacagagcatcaacttggagaagcccatggacggctaaaagaacagagacagctg
tctagtgaaaagctgatggacaaggaacagcaggttgctgacctccaaataaagctttca
cgttctgaggaggagctaaaggagaaagcagcaaatgcaactgaactgcagcatcagtta
gataaaatgaaacagcagcaccaggagcaacagaaccttcagcaaagtacaacagcaaag
ctgcgagaagctcagaatgatttggagcaagtgctacgtcagataggagataaggatcaa
aaaattcaaaaccttgaagccctgttacaaaagagtaaagagaatatctccttactagaa
aaagagagggaggatttgtatgccaaaatccaagctggtgaaggagaaacagcagttctt
aatcagctacaggagaagaaccacacattgcaagaacaggttactcagctgacagaaaaa
ctgaaaaaccagtcagaaagccataaacaggctctagagaatttgcatgagcaagtgcag
gagcaaaaggcacatctaagatcctctcaagaccgtgttgtctccttagaagcaactata
actgagctaaacagtcagttaagtgagagtaaagaaaaagtaattcaacttgatttgcag
gtaaaagcaaagactgagttgcttctaatagcggaagctgcaaaagctgcccaaagagca
gatctccagaatcatttggacactgcccagaatgcattacaagataaacagcaggaacta
aataaggtcaatacacagttggatcaggttacttctaaactccaagacaaacaggaatac
tgcactcagttggaaactaatcttaaagagtacaaagaaaaacatcttcatttagaacaa
aaaaaagaagaattggaaggtcagcgcaagaaacttgaagctgacattctggaaattaca
gaaagcaaagcaaaggcacttcaggagctgcagcagcaaagacaacaatgtacagactta
aatctcaaagctgcagaattgactaaactactagattcggaaagagaaatagtatccagt
atcaaattagatcttcaaaaaaaatgtgatgctctgggagaatcaaaccagcagatattg
aaacaagaagaagaaaatgcaagactgaaattagatattgaaaaattacatcaagaagca
gacaaacataataaagaattagatagaaaattacaagcaacaacagaagacttaaagaaa
ttagaattagaaaaggaaactctattaaaggaacttgaagctattaaaaataaattgtca
aagaacactgaatatttgaaagaagcaaaagatgaattagaaaaagagaaacagaaagga
aagacagcagtggcagaaatagagaaatcttgtcaagaagctagacggcaattgcagctg
cagtcagaatctatagctaaagaacaaaatgaattgaaaaactcattggaaaaacaagaa
gggatctccaagcaattggctacagagcttgaagcagcacgttcccaagtcctgcaaatt
caaggtgttttaaaagagaaagaaaagaatgaacagcagttgcagttaaaggtgaaagaa
ctgaaggaatctttcgatcagaaaaaaaagcaaaatgaaacacaacaagcagaattaaag
acagctctcttggaaaaggcagagcttgagaataaattgcagcagcagataacattatcg
gcacaagagctcacagcagaaagagaaaaggtaacagagttacagaagacctataaaaca
gctcaagaaaatacggaaaagcttcaactagatatttatggtaaagaatcagagctcttg
gctacacggcaagacctgaagtccattgaggaaaagcttgctttagctcaagaggagttg
gtttcaaacagaaatcaaattagtaatcacaatcagttgataaaagaacttaagattgta
agaactacgctggagcaggatgtatctaaaaaagaacagcaactgaaagagcaggagaaa
ttattacaagaaatgcagaaagataaggatttaaaagaaaaagacttgactaatgaaaaa
tccaaaatagcagaacttcagaagattaccagcaaacaggaaaaagaacattccaaactg
aaggaagaagctaaaataagcaagcaagagtttgagaaggagataacaaatctaaaggat
gccaagcaagtattgattaaacagaaactggaattacagggaaaggtggatagccttaat
acagctcttgaacaagagagaaagaaccaggaagctatcaaagatcaattgaaaaagaaa
gaagaagaaatgaagaagaaatgtgccgagttggaaacaaaactgcaagctgagatcaag
gagaaagctgaacagtgtaaaagtagcaaggaggctgaaggcaaattcaatatgcaaatc
acagctttgaatgagaatctggggactgtgaagaaagagtggcagagcagccaaaggagg
gttaacgagctagaaaaacaaatagacgatcttcgcggtgagatagcagtgcttgaagcc
acagtgcaaaataaccaggatgagaggagagtcttgttggaaaggtgccttaaaagtgaa
ggagaaattgaaaaacttcaaaacaaattgatggattcaagaagaaaactggatgacact
actgcagctatgcaagagctgggcagagagaaccagtccctgcagatcaaacatacacaa
gccctaaataggaaatgggctgaagacaatgaggttcagaattgcatgagctgtgggaaa
aacttttcggtaacaataaggaggcatcactgcagacaatgtggaaatatcttctgtgcc
gaatgctcatcaaagaatgccttaactccttcttctaagaaacctgttcgcgtctgtgat
acttgtttcattgacttgcaaggataa

DBGET integrated database retrieval system