KEGG   Anolis carolinensis (green anole): 100552426Help
Entry
100552426         CDS       T01608                                 

Gene name
os9
Definition
osteosarcoma amplified 9, endoplasmic reticulum lectin
Orthology
K10088  
protein OS-9
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Module
HRD1/SEL1 ERAD complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100552426 (os9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 634 aa AA seqDB search
MRRQGGSHRCLGRAETGGGGGRAEKMAARCLLSRFWGPLLLWAATLGGGEALGSLNLLEL
SELKYGIEIGAEPVLAGQSKSADVVTISSKYKQKYECRLPAAAVKIHQDKEEDPQSYTGL
GISELLKPMEAAPCLIKTKDWWTYEFCYGKHIQQYHMEESEIKGDILYLGYYQSAFDWDN
ETAKASKQHKLKRYHSQTYVNGSKCNLNGKPREAEVRFLCEEGAGDYIARVDEPQSCSYV
LTVHTTRICHHPFLRPPSTATPQTIRCHPALSPAEYVEYVKAQVCEYLSVILKEKSILNT
EESHLADFKKKIHFKIIRNPGDLVQFIHDLKESARKNKEKTSESEASAQDTSPKKEPKGE
REKPNEGAQEEEEEDEEELLGKFEKELEDILLQKSEMAELKEEVKSEMEKEFDHIINEVK
DELETEGLKGEFDRKQASKSLASTLNKLIDKLDSGKAPNKGDKEQEQKPEEDEEEEETPL
DGGDSAKEDAARAASDGNADGRVKVRVTKVKPGSARQKELRVQEMSRDNPQLRHIESVVK
DLLEKEGLKAEGKIEIKIVTTGGLGDDDDTHWLSEEDTKNLKDIFFNILIQGTEEAHKEQ
RRQRQLEDNYRFVWRRNQEDLPTTGGTDSDELDF
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaggcagggcggaagtcaccgttgcctaggaagagcagaaacaggcggaggaggc
ggccgtgcggagaagatggcggcgcggtgcctgctttcgaggttttggggcccgctgctg
ctctgggcggcgacgctgggtggcggagaggcgctgggctccttgaacctgctggagctc
agcgagctgaaatacggcattgagatcggggccgagccagtgttggccgggcagagtaaa
tcagccgatgtggtgaccatctcctcaaaatacaagcaaaaatatgagtgccggctgcct
gctgcagctgtgaagatacatcaggacaaagaggaagatccacagagctatactggcttg
ggaatctcagaactgctgaagccaatggaagctgccccttgccttatcaagactaaggac
tggtggacctacgagttttgctacgggaagcacatccagcaatatcacatggaagaatct
gaaatcaagggtgatatcctgtaccttggatattaccagtctgcatttgactgggacaat
gaaactgcaaaggcttctaagcaacacaaactgaagcgttatcacagccagacctatgta
aatggttccaagtgtaacctgaatgggaagcccagggaggctgaagtcaggttcctgtgt
gaggaaggtgcaggtgactacattgcccgtgtagatgaacctcagtcctgctcctacgtg
ctgaccgtccacaccacccgcatctgccatcacccattcctgcggcctccatcaaccgcc
acccctcagaccatccgctgccatccagctttgagcccagctgagtatgtagaatatgtc
aaggctcaagtgtgtgagtatctcagtgtcatcttaaaagaaaaatcaatcctaaacaca
gaagaaagtcatctggcagatttcaagaaaaaaatacactttaaaattatccggaatcct
ggagatctggttcagttcattcacgatttgaaggagagcgccaggaagaataaggagaag
actagtgaatcagaagcaagtgcacaagatacctcacccaaaaaagagccaaaaggagaa
agggagaagcctaatgaaggagcccaggaagaggaggaggaggatgaagaagaactgctg
gggaagttcgagaaggagctggaagacatcctgctacaaaaatctgaaatggccgaacta
aaggaagaggtgaaatctgagatggagaaggagtttgatcacatcattaatgaggtgaaa
gatgagctagaaacagaaggcctgaaaggagagtttgatcgaaaacaagcctctaagtct
ttggcatcaaccctcaacaagcttattgacaagctggattcaggcaaagccccaaataaa
ggagataaagagcaagagcagaaaccagaagaagatgaagaggaggaggaaacaccactg
gatggaggagattctgctaaagaagatgcagccagggcagccagtgatggcaacgcggac
gggcgcgtgaaagtcagggtcactaaagtcaagccaggtagcgctcgacagaaggagctg
cgagtccaagagatgagcagggacaacccgcagctgcgccacatagagagtgtggttaag
gacctgttggagaaggaaggcctgaaggcagaaggtaaaattgaaatcaagatagtgacg
acaggtggcttgggggatgacgatgacactcactggctgtcagaagaggacaccaagaac
ctcaaggatattttcttcaacattttgatccagggtacagaggaagctcacaaggaacag
cggcgccagcgtcagctggaagacaactaccgttttgtgtggagacgcaaccaggaggat
ctaccaactactggtggcacggattcagatgaattggatttctga

DBGET integrated database retrieval system