KEGG   Anolis carolinensis (green anole): 100552505Help
Entry
100552505         CDS       T01608                                 

Definition
profilin-3-like
Orthology
K05759  
profilin
Organism
acs  Anolis carolinensis (green anole)
Pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100552505
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100552505
Exosome [BR:acs04147]
 Exosomal proteins
  Proteins found in most exosomes
   100552505
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 137 aa AA seqDB search
MGDWKAYINTILKDKNIEDVAIVGHSDNKCVWASKPGGLLAAISPQEVGLITGQDRKAFL
QTGITIAGKKCSVIRDNLLVEKDAVMDTRTKGGDSRSICIGKTPKALIFVMGKKGVHGGA
LNKKVHDMIASMKTKGS
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggagattggaaagcctacatcaatacaatcctgaaggacaagaacattgaagatgta
gctattgtgggacactcggacaataaatgtgtctgggcgtctaagccaggaggcctgctg
gcagctatctctcctcaggaagtaggactgatcactgggcaggacagaaaagcgttcttg
caaactggaatcaccatagctgggaagaagtgcagtgtaatacgtgacaacctcttggta
gaaaaagacgccgtgatggacactcgaacaaaaggcggtgacagcaggtccatctgtatt
ggaaagactccaaaagctctcatcttcgtgatgggcaaaaaaggagtccacggaggagct
cttaataagaaagtccatgacatgatagcgagcatgaaaacaaaaggcagctag

DBGET integrated database retrieval system