KEGG   Anolis carolinensis (green anole): 100552555Help
Entry
100552555         CDS       T01608                                 

Gene name
tesk1
Definition
(RefSeq) testis-specific kinase 1
  KO
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100552555 (tesk1)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100552555 (tesk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 720 aa AA seqDB search
MRGGALGGVRALPRSPPSPHPSAAMEGPRAPRRPPPPAALPSPQREEGPAEPPPQPPSSS
RPRPSSYRALRSAVSTLARLDDFFCEKIGAGFFSEVFKVRHRQSGHIMVLKMNKLMSNRG
NMLREVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINGGNLEQLLDSPTPLPWPVRIKL
ALDIARGLRYLHSKGIFHRDLTSKNCLVRCEDNGYTAVVGDFGLAEKIPTYSEGSEKEPL
AVVGSPYWMAPEVLRGELYNEKADVFAYGIILCETIARIPADPDYLPRTEDFGLDVPSFC
NLVGPDCPMTFLQLAFHCCSMDPTSRPSFLEITQRLEAILEQQLAHRDPGSPDGKSNTGS
NGSCRRRNLPGSPVALLNGQAPQDPACVHPPPGLLSVQQLLPLDQRLSRSQSDMFPSPSP
SPAPPDSTPQRVNPFSQRQDLKGGRIKLFDTPSKSLISLTFDLPPPSPLQPGIPITPDPM
VEAQCDFSEASSSSSFSALSPRRCRSLPSSPEMPHRQGKPHVDPHHCANGPLALDCSRLE
ADPETPEMMDCRPDASPDPEPPAALLPPPAPPPAPATNSNCISTAVSRAPRLWPPNGVLL
NNNSKPPGSWGGGLSELSVAPHMDEGAALALGGPEGTVAPADPEEEMLSCPACCLGPFGF
SLASVCHRPSASSTPRYQNLNCEARSLQGPERGAPGPRKGPQRPGALSSEPSLKLPEAQS
NT seq 2163 nt NT seq  +upstreamnt  +downstreamnt
atgcggggcggcgcgctgggaggcgtgcgggccttgcctcgctctccgccctctcctcat
ccctcagcggccatggagggtccgcgggcgccgcgcaggccccctccgcccgccgctctc
ccgtcccctcagcgcgaggaaggccccgcggagcccccgcctcagcctccgtcctcgtcg
cggccgcggccttcctcgtaccgggccctgcgcagcgccgtctccaccctggcccgcctc
gacgacttcttctgcgagaagatcggcgccgggttcttctcggaggtcttcaaggtgagg
caccgccagtcggggcacatcatggtgctgaaaatgaacaagctgatgagcaaccggggc
aacatgctccgcgaggtgcagctcatgaaccgcctctcccaccccaacatcctccggttc
atgggcgtctgtgtccaccagggccagctccacgccttgactgagtacatcaacggaggg
aacctggagcagctgctggacagccccacgccactgccctggccggtccgcatcaagttg
gcgctggacatcgcgcggggcctccgctacctgcacagcaagggcatcttccaccgggac
ctcacctccaagaactgcctcgtccggtgtgaggacaatggctacacggcagtggtggga
gacttcggcctggcggagaagatccccacctacagcgaagggagtgaaaaggagcccctg
gcggtggtggggtctccttactggatggcccctgaggtcctgcgcggggagctctacaat
gagaaggccgacgtctttgcctacggcatcatcctctgcgagaccatcgcccgcatcccg
gccgacccggactacctgccccggacggaggactttgggctggatgtgccctccttctgc
aacctggtgggacccgactgccccatgaccttcctccagctggccttccactgctgcagt
atggaccccacgtcgcggccgtccttcctggagatcacgcagcggctggaggccatcctg
gagcagcagctggcccaccgagaccctgggagtcccgacgggaagagcaacacgggcagc
aatggcagctgcaggaggaggaacctccctgggagcccagtggccctgctgaacggtcaa
gcaccccaggaccccgcctgcgtccacccgccgcccggcctcctctccgtccagcagctc
ctccccttggaccagcgcctctcccgcagccagtcggacatgttcccctccccttctccg
tcccccgcccccccggacagcactccgcagcgagtgaaccccttttcccagcgccaggac
ctgaaggggggccgcatcaagctctttgacacccccagcaagtccttgatctccctgacc
tttgacctcccgcccccctccccactccagccgggcatccccatcaccccggacccgatg
gtcgaggcccagtgtgacttctccgaggcctcctcctcctcttccttctctgccttgagc
ccccgccggtgccgctccctcccgtcctccccagagatgccccatcgccaggggaagccc
cacgtggaccctcatcactgcgccaacggccccttggccctggactgcagccgcctggag
gccgaccccgagacccccgagatgatggactgccgcccagacgccagcccggacccagag
ccccccgccgccctgctcccgcccccggcccctccgccagcgccggcgaccaacagcaac
tgcatcagcacggccgtctcccgggccccgcggctgtggccccccaacggggtcctcctc
aacaacaacagcaagccccccggcagctggggcgggggcctctcggagctgagcgtggcg
ccccacatggacgaaggggcggcgctggccctggggggccccgaggggaccgtggccccc
gccgaccccgaggaggagatgctctcctgcccggcctgctgcctggggcccttcggcttc
agcctggcctccgtctgccaccggcccagcgccagcagcaccccccgctaccagaacctc
aactgcgaggccaggagcctccagggccccgaaaggggggcaccggggccacgcaaggga
ccccagaggcccggagccctgtcctcagagcccagcctcaagctgcccgaagcacagtcc
taa

DBGET integrated database retrieval system