KEGG   Anolis carolinensis (green anole): 100552598Help
Entry
100552598         CDS       T01608                                 

Definition
uricase-like
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100552598
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    100552598
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     100552598
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 292 aa AA seqDB search
MHCIKELEISVHIKLDTMNEYLHSDNTKVIPTDTIKNSIEALAKIRGINTIEQFGLDICD
HFLTSFCHVVYCNAFIQEVPWQRLEKDGTPHVHAFLYSSEGVRFCEVEQSVDGAPIVFSG
IKDLKIMKTTQSGFQNFYKDKYTTLPERRDRILSVEMLIKWCYGVCPEGLDYDCIWRTAH
ESALDAFAGPPETGHYSPSYQKTVNCVQEYILEKIPQVEEVEVICSNIHYSLTPLEKLGL
CNDKEIFTPQDTPFGACASTLRRKKGPEEECDTVVESKTHCSAGWKPALKSN
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgcattgcatcaaagaactggaaatctctgtacatataaaactggacactatgaatgaa
tacctgcattctgataacaccaaagttatccccactgacaccataaagaattcaattgaa
gctctagccaaaattcgtgggatcaacacgatagaacagtttggccttgacatctgtgat
cacttcctcacctcattttgccacgttgtgtattgcaatgccttcatccaagaggtgcca
tggcagcgcctagaaaaggatggtaccccacatgtacatgcttttctgtatagctctgaa
ggggttcgattttgcgaagtagaacagtctgtggatggtgcaccaattgttttctctggc
atcaaagatctgaaaattatgaaaacaacccaatctggatttcaaaacttctacaaggat
aagtacaccacacttccagaaagaagagatagaattctctcagtggaaatgttgataaag
tggtgctatggtgtatgcccagaaggccttgactatgactgtatatggagaactgcacat
gaaagtgcccttgatgcctttgctggaccacctgaaacaggccattactccccttcttac
cagaagactgtcaactgtgttcaggaatacatcctggaaaaaatcccacaggtggaagaa
gtggaagtgatctgttccaacatccattattcactgacacctctagaaaaactggggttg
tgcaatgacaaggagatctttacacctcaggatacaccctttggggcttgtgcatcaacg
ctgcgtaggaagaagggcccagaagaagagtgtgacactgtcgtagagagcaaaacccac
tgctctgctggatggaagcctgccctgaagtcgaattaa

DBGET integrated database retrieval system