KEGG   Anolis carolinensis (green anole): 100552636Help
Entry
100552636         CDS       T01608                                 

Gene name
plcd4
Definition
(RefSeq) phospholipase C delta 4
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00562  Inositol phosphate metabolism
acs01100  Metabolic pathways
acs04020  Calcium signaling pathway
acs04070  Phosphatidylinositol signaling system
acs04933  AGE-RAGE signaling pathway in diabetic complications
Module
acs_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100552636 (plcd4)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100552636 (plcd4)
   04070 Phosphatidylinositol signaling system
    100552636 (plcd4)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100552636 (plcd4)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100552636 (plcd4)
Membrane trafficking [BR:acs04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100552636 (plcd4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100552636 (plcd4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5 PH_12 Pox_Ag35 Trypan_PARP CDC45
Motif
Other DBs
NCBI-GeneID: 100552636
NCBI-ProteinID: XP_016849602
Ensembl: ENSACAG00000002589
Position
1
AA seq 768 aa AA seqDB search
MASALTSRIQPDENLEKMQQGTMMRKVKSKNWKKPRFFLLKDDSMTVWYKSKMSGNAKSA
FSVSDVETVREGHQSEVLQSLAEEFPAECCFTVVFHGRRKNLDLIAGSAEEAQCWIQGLR
RLVEIVTNMDQREKIDQWICDWFQKADKDKDGRMNFKEVQALLRMMNVDMNEGHAYRLFK
MADKSQTGTLEGEEFVLFYKALTQRDEVLEIFQEYSEDGKKLTLLEFVDFLQQEQMESSG
IDELAMELIDRYEPSETAKARHILSTDGFLMYLCSPDGSIFNPEHTKVHQDLSQPLCHYF
ISSSHNTYLMEDQLRGQSSVEGYIRALKRGCRCLEVDCWDGSNGEPIVYHGHTFTSKIPF
RDVVATLQKYAFRASEYPIILSIENHCSIEQQDIMAQHLKGILGEQLLLSTIDGRVPVQL
PSPEQLKGKIILKGKKMGYLEDSLNGQPEEMPEREEGEEEEEEEEEEAEPEPESEQDTLR
SEDKRKEKKAKQSLSKELSDCIIYCKSVPFFSFQHSRSHYKPYEMSSFAESKTRKLIRDA
GNDFVRHNAWQLTRVFPSGLRTDSSNYNPLMMWNVGCQMVALNFQTAGTEMDLYDGLFSQ
NGRCGYVLKPSFMRDPETAFSPENPQNSGGRSPLNLFIKVISGQQLPKMPNSKEGSIVDP
LVRVEIHGVPGDNAKQESKYIDNNGFNPKWNESFRFQVWVPELALLRFVVEDYDKATWND
FVGQYTLPLTSVKPGYRHIHLLSKDGTRIPPASLFVHIRIVELSAESD
NT seq 2307 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgcacttacttcccgtattcaaccagatgagaaccttgaaaagatgcaacaa
ggaacaatgatgcgcaaggtcaaatccaagaactggaaaaaaccacgattttttctgtta
aaggatgacagcatgactgtctggtacaaatctaagatgtctggcaatgccaaatctgca
ttctctgtgagtgatgtggagacggtgcgtgagggacaccaatcagaagtattgcaaagt
ttagccgaggagttcccggccgagtgctgtttcaccgttgttttccatgggcgccgaaaa
aacctggacctaattgctggctcagcagaagaagctcagtgttggatccaaggtctgcga
cgtcttgtggagattgtcactaacatggaccagagagagaagatagaccaatggatctgt
gattggttccagaaagctgataaggacaaggatgggcgcatgaacttcaaggaagtgcag
gccttactcaggatgatgaatgtggatatgaatgagggccatgcctaccggctgttcaag
atggctgacaaatcacaaacaggaacactggagggagaggaatttgtgctgttctacaag
gcattaacacaacgggacgaagtacttgagatcttccaggagtactctgaagatggcaag
aagctgacactgttggagtttgtggattttctgcaacaagagcaaatggaaagcagtggc
attgatgaacttgccatggagctgattgacagatatgagccatctgaaacagccaaagct
cgccacattctgagcactgatggattcctcatgtacctttgttcacccgacggctccatc
ttcaaccctgagcacacgaaagtccaccaggacttgtctcagcccctctgccattatttt
atctcttcctctcacaacacgtatctgatggaggatcaactgcgaggacagagcagtgtt
gaaggatatatcagggctctaaaacggggatgccgctgcctagaagtggactgttgggat
ggatctaatggtgagcccatcgtttaccatggccataccttcacttctaagatccccttt
cgggacgttgtggcaaccctccagaaatatgcattcagggcgtctgaatatcctatcatc
ctgtctattgaaaatcactgcagcatagagcagcaggatatcatggcgcaacacctgaaa
ggaattctgggagagcagctcctcctcagcaccattgatgggcgagtccctgtgcagctg
ccttcacctgaacaactgaaagggaagatcatcctaaagggcaagaagatggggtatttg
gaggattctctgaatggacagccagaggagatgccagagcgggaagagggtgaggaggaa
gaggaggaggaggaggaggaagcagagccagagccagagtcagagcaagacaccctgcgc
tctgaagacaagaggaaagagaagaaagccaaacaatctctctccaaggagctttcggac
tgcattatctactgcaagagtgtgcccttcttcagtttccagcattctcgtagccactac
aagccttacgaaatgtcttcctttgctgaatccaagacacgcaaactcatacgtgatgct
gggaatgacttcgtccgccataatgcctggcagttgacacgcgtctttcctagtggcctc
cgaactgactcttccaattacaatcctctgatgatgtggaacgtggggtgccagatggtg
gccttgaattttcaaactgctggcacagagatggacttgtatgatgggctcttcagccaa
aatggccgttgtggctatgtgttgaagccaagcttcatgagggacccagaaacagctttc
agtcctgagaatccccaaaacagtggtggcagaagtccactgaacttattcattaaggtt
attagtgggcagcagctccccaagatgcccaacagcaaagagggttccattgtggatcca
ctggtgagagtggagattcatggggtcccaggtgacaatgccaagcaagagagcaaatat
attgacaacaatgggtttaatccaaaatggaatgaaagcttccggttccaagtatgggta
ccagaactggcacttctgcgatttgtggtagaggattatgacaaggcgacatggaatgat
tttgttgggcagtacacactgcctcttactagtgtcaaaccaggataccgccacatccac
cttctttcaaaggatggtacaaggatcccaccagcttctctcttcgtccacatccgcatc
gtggagttgtcagctgagagcgactga

DBGET integrated database retrieval system