KEGG   Anolis carolinensis (green anole): 100552654Help
Entry
100552654         CDS       T01608                                 

Gene name
tesk2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100552654 (tesk2)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   100552654 (tesk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 675 aa AA seqDB search
MDRSKRNSIAGFPPRLERLEDFDGGGSDGTVSQMGRVWTSSYKALISAFSRLTRLDDFSC
EKIGSGFFSEVFKVRHKVSDQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILKFMGVCV
HQGQLHALTEYINCGNLEQLLDGNQHLPWTVRVKLALDIALGLCYLHFKGIFHRDLTSKN
CLIKHDESGYSAIVGDFGLAEKIPDFSEKLPVVGSPYWMAPEVLRDEPYNEKADVFSYGI
ILCEIIARIQADPDFLPRTENFGLDYDAFQHMVGDCPPNFLQLAFNCCNMDPKLRPSFAD
IVKALEEILSNLKSEEDERERKLLMLDNTERKPISVSKGLLERGQGFKRLSSLDDKIPPK
SPRPRRNIWLSRSQSDIFSRKPCRKINVQDPYYTPSKGANRKVNPFNSREDLKGGKIKFF
DMPSKSVISLVFDLHSPEAGTYLKMSQPQFRPSYSIDWQESSFLPGRRSRSLPVSPEFVH
KGYSTFGDLSATVSRCDPSQLGAEVRQKLLSSNKYGVSEIPPFQAKHHRQVSSFLQEEEM
DCSDGLQPQEENGFCPLKTSLEEPELRQTMGHILQDAQNADGPLVQDLDCSEDRSSEMFM
SCATSEDMEVEDETQRNMPSTKLESSKLLFSANSSPQPGRVSSLFEAVDSDTSNLVSLPS
SNAPAPVNEQSKCDI
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggatcgaagtaagcgaaattcaattgcaggatttccaccacgcttggagcgtcttgaa
gactttgatggtggcggaagtgatgggactgtgtcccagatgggcagagtctggacttct
tcatacaaggccttgataagtgccttttcaagacttacacggcttgatgacttttcttgt
gagaaaataggatctggtttcttctctgaggtattcaaggtgcggcacaaggtatctgat
caagtaatggctttgaagatgaatacactaagtagcaaccgtgcaaacatgctaaaagaa
gtccagctcatgaacagactttcacatccaaacatactaaagtttatgggtgtctgtgta
catcaaggacagttgcatgctcttactgagtatatcaactgtggtaacctggaacaatta
ttagacggcaatcagcatcttccctggacagtgagagtgaaactggccttggacattgct
ctaggactttgttatcttcactttaaaggcattttccatcgagatttaacatctaagaac
tgtttgataaagcatgatgagagtggatattctgctatagttggtgactttggcttggca
gagaaaatcccagattttagtgagaagctgccagtggtggggtctccttattggatggca
cctgaagtgctgagagatgagccatacaatgaaaaggcggatgtcttctcatatgggatc
attctttgtgaaattatagccaggatccaggccgatccagactttctccctcgcacagag
aattttggattggattatgatgcctttcagcatatggtaggagattgtccgccgaacttc
ctccagttagccttcaactgctgcaacatggacccaaagttacgcccttcatttgctgac
attgtcaaggcactggaggaaatcttgagcaatttgaaaagtgaagaggatgaaagagaa
aggaagcttctaatgttggacaatactgaaagaaaacccatctctgtttcgaaaggatta
ctagagagaggacaaggattcaaaagactgagctcactggatgacaagatcccacctaag
tctccccgtccacggcgcaacatctggttgtcacgcagtcaatcagacatcttctctcga
aagccttgtcgcaaaataaatgtgcaggatccttactacacaccaagcaaaggagcaaac
cgcaaagtcaaccccttcaattctagggaagacttgaaagggggaaagatcaaatttttt
gacatgccaagcaaatctgtgatatctcttgtatttgatttgcactctccagaagcagga
acgtatctgaagatgagccaaccgcagtttaggccatcatacagcattgactggcaagaa
tcctctttccttcctggaagacggagcagatcactcccagtctctcctgaatttgtacat
aaaggttatagtacatttggggatctctcagcaactgttagtaggtgtgatcctagtcag
ttaggggctgaagtgcggcagaagctactgagcagcaataagtatggtgtgtctgagatc
cctccttttcaagccaaacatcataggcaagtgtcttcttttcttcaagaggaagagatg
gattgctctgatggattacagcctcaagaagaaaatggattttgccctcttaaaacttca
cttgaggaacctgaactcaggcagacaatgggacacattctgcaagatgcccagaatgca
gatgggcctttggtacaggatttagactgttcagaagatagatcttcagagatgttcatg
agctgtgccacctctgaagatatggaggtagaagatgaaactcaaaggaatatgccttcc
actaagctggagtcttccaaactgttgttcagtgctaattcttccccacaaccaggcaga
gtgtcttctctttttgaagcagtggatagtgacacctcaaatctggtttctcttccatct
tcaaatgcaccagcaccagtaaacgagcagtcaaaatgtgacatttaa

DBGET integrated database retrieval system