KEGG   Anolis carolinensis (green anole): 100552678Help
Entry
100552678         CDS       T01608                                 

Gene name
usp12
Definition
(RefSeq) ubiquitin specific peptidase 12
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100552678 (usp12)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100552678 (usp12)
Ubiquitin system [BR:acs04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100552678 (usp12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 502 aa AA seqDB search
MASAGQKKEGGASQVFHSFRPRRVFSKFIVVYKRGRGRLGLVRVCGGSRALRRLREPEGG
GWLWSERRWRALWSVGGREGGVLRRPLSLFQSPAAGRRRRRRRLLPRLLPPAGLCPSGSP
RRCDWVEDGAARMEILMTVSKIASICTMGANASALEKEIGPEQFPDNEHYFGLVNFGNTC
YCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGVIPPKKFIT
RLRKENELFDNYMQQDAHEFLNYLLNTVADILQEERKQEKQNGRLPNGCIDSENNNSLPD
PTWVHEIFQGTLTNETRCLTCETISSKDEDFLDLSVDVEQNTSITHCLRGFSNTETLCSE
YKYYCEECRSKQEAHKRMKVKKLPMILALHLKRFKYMDQLHRYTKLSYRVVFPLELRLFN
TSGDATNPDRMYDLVAVVVHCGSGPNRGHYIAIVKSHDFWLLFDDDIVEKIDAQAIEEFY
GLTSDISKNSESGYILFYQSRD
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgcgggccaaaagaaagagggaggggcttcgcaagtgttccactccttccgg
ccacggcgggtctttagcaagtttatcgtcgtctacaaaagagggagggggaggttgggc
ttagtgcgcgtgtgcggaggctcgcgagcactgagaagactacgggagccggaaggagga
ggatggctgtggagtgagcggaggtggcgcgcactttggtcggttggagggagggagggc
ggagtcctacgtcggcctctctctctctttcagtccccagctgctgggaggaggcggagg
cggcgccgccttcttcctcgccttcttcctccggcgggactctgcccctccggctcccct
cgacgttgtgattgggtagaagatggcgccgcgcggatggaaatcctaatgacagtctcc
aaaatcgcctccatctgtaccatgggcgctaatgcctcggccttagagaaagaaattggt
ccagaacagtttccagacaatgaacactattttggtttagtaaattttggaaatacatgc
tactgcaattcagttcttcaggcactttatttttgtcgtccatttcgagagaaagtcttg
gcatacaaaagtcaacctagaaaaaaagagagccttctcacctgcttagctgatctcttt
cacagcatagccactcagaagaagaaggttggagtgatacctcctaaaaagttcataaca
agactacgaaaagagaacgagctctttgacaactatatgcagcaagatgcacatgagttt
ttaaactatctattgaatacggtagcagacattttacaagaagagagaaagcaggaaaag
caaaatggtcgtctgccaaatggctgtattgacagtgaaaacaataacagtctgccagac
ccaacatgggttcatgaaatctttcagggaacattaacaaatgaaacaagatgtctcact
tgtgaaacaataagcagcaaagatgaagacttcttagatctttctgttgatgtggagcaa
aatacttcaattacacactgtttaaggggtttcagcaatacagaaactctgtgcagtgaa
tataaatattactgtgaagagtgtcgcagtaaacaggaagcacacaaaagaatgaaagtg
aaaaaactgcccatgattctggctctccatctgaagagatttaaatatatggatcagcta
catcgatatacaaaactttcttacagggtagtatttcccttagaacttcgtctgtttaat
acatcaggagatgccacgaatcctgacagaatgtatgatcttgtggctgtggtagttcac
tgtggaagtggacctaacagaggacactatattgcaattgtgaagagtcatgatttttgg
ttgctttttgatgatgacattgtagagaaaatagatgcacaagctattgaagaattctac
gggttgacatcagacatctcaaagaattcagagtctggttatatccttttctatcagtct
cgggattga

DBGET integrated database retrieval system