KEGG   Anolis carolinensis (green anole): 100552690Help
Entry
100552690         CDS       T01608                                 

Gene name
tymp
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00240  Pyrimidine metabolism
acs00983  Drug metabolism - other enzymes
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100552690 (tymp)
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100552690 (tymp)
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100552690 (tymp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_3 Glycos_trans_3N PYNP_C Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 100552690
NCBI-ProteinID: XP_008120562
Ensembl: ENSACAG00000011062
Position
Un
AA seq 473 aa AA seqDB search
MQPYGAMDPNVSSSSRPSMLDIIQKKRDGKKLQEEEIGYFVKAVTQGELRDAQIGAMLMA
TWLKGMEPEETLALTREMATSGRVLKWPEKWRGLLVDKHSTGGVGDKVSLPLAPALAACG
CKVPMISGRGLGHTGGTLDKLESIPGFRVSQSPEQMKKILQKVGCCIVEQSQELVPADKI
LYALRDVTATVDSVPLATGSILSKKVAENLSALVLDVKIGNGAVFPTLESAQQLAESLVS
VGTQLGINTVAIFSKMDSPLGRRVGNSLEVLESLECLDGGGPTDLRELVTTLGGTLLWQC
GRAPSVSQGSARIAKALDDGSALGAFRAMLQAQGVDANTAKALCHGTEEQRLQVLGSPRV
QTALVAHCDGTVHQILAMPIAQVLHALGAGRTKEGQRIQHQVGAELLVSVGERVRKGMPW
IWIHCVSLELSDANRSTLQSALIIKDTEPFVPGPKVVKTLLPKVSEVPRKTDT
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgcagccttatggagccatggaccccaatgtgagcagcagcagcagacccagcatgctg
gacatcatccagaagaagcgggacggcaagaagctgcaggaggaggaaattggctatttt
gtgaaggccgtgacccaaggagagttgcgagatgcacaaattggagcgatgctgatggcc
acctggctgaagggcatggagccggaggagacactggcattgacccgggagatggccacc
tcggggagagtcctgaagtggccagagaaatggcgggggctgctggtggacaagcactcc
acggggggcgtgggggacaaggtcagcctgcccctggcccccgccctggccgcctgtggg
tgcaaggtgcccatgatcagcgggagaggcctgggccacactggaggcacactggacaag
ctggagtccatccccggattcagagtttcccagagtccagaacagatgaagaagatcctg
cagaaggttggctgctgcatcgtggagcagagccaggagctggtcccggcagacaagatc
ctctatgccctgagggacgtcacggccaccgtggacagtgtgcctctcgccaccggttcc
atcctgagtaagaaggtggctgagaacctctctgctttggttctggatgtcaagattggg
aacggtgctgtcttcccgacccttgagagcgcccagcagctggccgagagcttggtgtca
gtcgggacccagctgggaataaacaccgttgctatcttcagcaagatggacagccctctt
gggcgccgggtgggcaattccttggaggtgcttgagtccctggagtgcctggatggaggg
gggcccacggacctccgcgagttggtgaccacgttaggaggaaccttgttgtggcaatgt
gggagagctccctctgtgtctcagggctctgctcgcattgccaaagccttggacgatggc
tcagccctgggcgccttccgggctatgctccaggcccaaggggtggacgccaacacagcc
aaggccctgtgccatgggactgaagaacagaggctccaggttctgggaagtcctcgggtc
cagacggcgctggtggctcattgcgatgggaccgtccatcagatccttgcaatgcccatt
gctcaggtgctccatgctttgggggccggtcgcacgaaagaaggccagcggatccagcac
caggttggggctgagcttctggtctctgtgggagaacgagtgaggaaaggaatgccatgg
atctggatccattgtgtcagccttgaattaagcgatgccaaccgaagcaccctccagagt
gctctcatcataaaggacacggagccctttgtccctggaccgaaggtggtgaaaaccctt
ctcccaaaagtgtcagaggtccccagaaaaacagacacttag

DBGET integrated database retrieval system