KEGG   Anolis carolinensis (green anole): 100552690Help
Entry
100552690         CDS       T01608                                 

Definition
thymidine phosphorylase-like
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Pyrimidine metabolism
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    100552690
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    100552690
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     100552690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
MAAGDSVEVLVDLYNTNMAREVDTIAPERPLSSRSQNSCQYWRGGHLASIQSSEDEKEIS
NYIRKITRNNTVWIGFHAERVSSLLPGGHRKIAPTYIHTCASTEQHTRPVVDLQQQMERE
ERTSLEIQRKKDSCLYWRGGHLASIQSMKEEKDISEYIRRISRASSVWIGFRAKLASSNS
CQYWRDGHLASIKSPIEEEKINAYIRSNSKQHTVWIGFRATLVSSISREDSGQPWPCLQT
SGSEAGGLTGPEGPLQPFTVAQDPSTGSRPMMQPYGAMDPNVSSSSRPSMLDIIQKKRDG
KKLQEEEIGYFVKAVTQGELRDAQIGAMLMATWLKGMEPEETLALTREMATSGRVLKWPE
KWRGLLVDKHSTGGVGDKVSLPLAPALAACGCKVPMISGRGLGHTGGTLDKLESIPGFRV
SQSPEQMKKILQKVGCCIVEQSQELVPADKILYALRDVTATVDSVPLATGSILSKKVAEN
LSALVLDVKIGNGAVFPTLESAQQLAESLVSVGTQLGINTVAIFSKMDSPLGRRVGNSLE
VLESLECLDGGGPTDLRELVTTLGGTLLWQCGRAPSVSQGSARIAKALDDGSALGAFRAM
LQAQGVDANTAKALCHGTEEQRLQVLGSPRVQTALVAHCDGTVHQILAMPIAQVLHALGA
GRTKEGQRIQHQVGAELLVSVGERVRKGEL
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atggcggctggtgattctgtcgaagttttggttgatctctataacaccaatatggccagg
gaagtagacacgattgcccctgaacgtcccctatcgtctcgcagtcagaattcctgccag
tactggcgagggggtcacttggcttccattcagtcatcagaagatgaaaaagagatttct
aattacattaggaaaatcacccgcaataacacggtctggattggtttccatgctgaacgt
gtctcctcgcttctgccaggtgggcacaggaaaattgctccaacatatatccatacctgt
gcaagtaccgagcagcatactaggcctgtggtggaccttcagcaacaaatggagcgtgaa
gagaggacatcccttgagatccagcggaagaaggattcctgcctgtactggcgagggggt
cacttggcttccattcagtcaatgaaagaggaaaaagatatttctgaatacatcaggaga
atcagcagggcaagcagtgtctggattggtttccgtgccaaacttgcctcctcgaattcc
tgccagtactggagagatggtcacttggcttccattaagtcaccaatagaggaagaaaag
attaatgcttacatcaggagcaacagcaaacaacacactgtctggattggtttccgtgcc
acacttgtctcctcgatctctcgggaagatagcggtcagccttggccatgtctgcagacg
tctgggtcggaagctggcggcctcaccggccccgagggcccattgcagccctttacagta
gcccaggacccaagtacgggctcccgaccaatgatgcagccttatggagccatggacccc
aatgtgagcagcagcagcagacccagcatgctggacatcatccagaagaagcgggacggc
aagaagctgcaggaggaggaaattggctattttgtgaaggccgtgacccaaggagagttg
cgagatgcacaaattggagcgatgctgatggccacctggctgaagggcatggagccggag
gagacactggcattgacccgggagatggccacctcggggagagtcctgaagtggccagag
aaatggcgggggctgctggtggacaagcactccacggggggcgtgggggacaaggtcagc
ctgcccctggcccccgccctggccgcctgtgggtgcaaggtgcccatgatcagcgggaga
ggcctgggccacactggaggcacactggacaagctggagtccatccccggattcagagtt
tcccagagtccagaacagatgaagaagatcctgcagaaggttggctgctgcatcgtggag
cagagccaggagctggtcccggcagacaagatcctctatgccctgagggacgtcacggcc
accgtggacagtgtgcctctcgccaccggttccatcctgagtaagaaggtggctgagaac
ctctctgctttggttctggatgtcaagattgggaacggtgctgtcttcccgacccttgag
agcgcccagcagctggccgagagcttggtgtcagtcgggacccagctgggaataaacacc
gttgctatcttcagcaagatggacagccctcttgggcgccgggtgggcaattccttggag
gtgcttgagtccctggagtgcctggatggaggggggcccacggacctccgcgagttggtg
accacgttaggaggaaccttgttgtggcaatgtgggagagctccctctgtgtctcagggc
tctgctcgcattgccaaagccttggacgatggctcagccctgggcgccttccgggctatg
ctccaggcccaaggggtggacgccaacacagccaaggccctgtgccatgggactgaagaa
cagaggctccaggttctgggaagtcctcgggtccagacggcgctggtggctcattgcgat
gggaccgtccatcagatccttgcaatgcccattgctcaggtgctccatgctttgggggcc
ggtcgcacgaaagaaggccagcggatccagcaccaggttggggctgagcttctggtctct
gtgggagaacgagtgaggaaaggtgagctctag

DBGET integrated database retrieval system