KEGG   Anolis carolinensis (green anole): 100552727Help
Entry
100552727         CDS       T01608                                 

Definition
glucose-6-phosphatase-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acs00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:acs00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:acs00500]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:acs04068]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:acs04910]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:acs04920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 353 aa AA seqDB search
MDLLHSAGVQATSYLQENFIAFQDWFIFISTVADLRTTFFVFFPIWFHLREAVGIRLIWV
AVIGDWLNLVFKWILFGERPYWWVHETDFYGITTPPVIKQFPITCETGPGSPSGHAMGSS
GVYYIMVTALISHLLPLKQKNLSARCLRAFLWTGFWAVQVCVCLSRVFLAAHFPHQVVSG
VISGMLVAEVFEHVRSIYNANLQRYVNTTFFLFGFALGFYLLLKLLGVDLLWTLEKAHKW
CERPEWVHIDTTPFASLLRNLGILFGLGLGLNSPMYAESCKGKQSQQLTFRLTCIVSSLF
ILHLFDSFELPTNREILFYILSFCKSACAHICAVALIPYCISQLLKLARKKDL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctcctgcatagtgcaggggtccaagccaccagctacctccaagagaacttcata
gccttccaggactggtttatcttcatctccacagtggccgacctccgaacaacgttcttt
gtcttcttccccatctggttccatctgagggaagctgtgggaatccgtctcatctgggtc
gctgtgatcggggactggctcaaccttgttttcaaatggatccttttcggagagaggccc
tactggtgggtgcatgaaaccgatttctatggcatcacaacacctcctgtgatcaaacag
tttcccatcacctgtgagactggcccaggtagcccttctggacatgccatgggatcttct
ggcgtctactacatcatggtgacggcactgatatcacatctattgccactgaaacaaaaa
aacttgtcagcaaggtgcctgcgtgcctttctctggacaggattctgggcagtgcaggtt
tgtgtctgtttatcccgggtcttccttgctgcacactttccacaccaggtggtctctggt
gtgatctcagggatgttggtggcagaggtttttgagcacgtccgttccatctacaatgca
aacctgcagcgatatgtgaatacaaccttcttcctttttggctttgccctgggcttttac
ttgctgctcaagttgctgggtgtggacctcctgtggacactggagaaggcccacaagtgg
tgtgaacggccggagtgggtccatattgacacaacaccttttgccagcctgcttcgcaac
ctgggcatcctgtttggactgggcttaggcctcaactccccgatgtatgctgagagctgc
aaagggaagcaaagccaacagctgaccttccgcctcacctgcatcgtttcctccctgttc
atcctccacctgtttgattcctttgaactgcccaccaacagagagatcctcttctacatc
ctctccttctgcaagagtgcttgtgcccatatctgtgcagtggccttgattccctattgt
atctcccagctgctgaaactggcaaggaaaaaagacttatag

DBGET integrated database retrieval system