KEGG   Anolis carolinensis (green anole): 100552727Help
Entry
100552727         CDS       T01608                                 

Definition
glucose-6-phosphatase-like
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100552727
   00052 Galactose metabolism
    100552727
   00500 Starch and sucrose metabolism
    100552727
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100552727
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100552727
   04920 Adipocytokine signaling pathway
    100552727
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     100552727
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 353 aa AA seqDB search
MDLLHSAGVQATSYLQENFIAFQDWFIFISTVADLRTTFFVFFPIWFHLREAVGIRLIWV
AVIGDWLNLVFKWILFGERPYWWVHETDFYGITTPPVIKQFPITCETGPGSPSGHAMGSS
GVYYIMVTALISHLLPLKQKNLSARCLRAFLWTGFWAVQVCVCLSRVFLAAHFPHQVVSG
VISGMLVAEVFEHVRSIYNANLQRYVNTTFFLFGFALGFYLLLKLLGVDLLWTLEKAHKW
CERPEWVHIDTTPFASLLRNLGILFGLGLGLNSPMYAESCKGKQSQQLTFRLTCIVSSLF
ILHLFDSFELPTNREILFYILSFCKSACAHICAVALIPYCISQLLKLARKKDL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctcctgcatagtgcaggggtccaagccaccagctacctccaagagaacttcata
gccttccaggactggtttatcttcatctccacagtggccgacctccgaacaacgttcttt
gtcttcttccccatctggttccatctgagggaagctgtgggaatccgtctcatctgggtc
gctgtgatcggggactggctcaaccttgttttcaaatggatccttttcggagagaggccc
tactggtgggtgcatgaaaccgatttctatggcatcacaacacctcctgtgatcaaacag
tttcccatcacctgtgagactggcccaggtagcccttctggacatgccatgggatcttct
ggcgtctactacatcatggtgacggcactgatatcacatctattgccactgaaacaaaaa
aacttgtcagcaaggtgcctgcgtgcctttctctggacaggattctgggcagtgcaggtt
tgtgtctgtttatcccgggtcttccttgctgcacactttccacaccaggtggtctctggt
gtgatctcagggatgttggtggcagaggtttttgagcacgtccgttccatctacaatgca
aacctgcagcgatatgtgaatacaaccttcttcctttttggctttgccctgggcttttac
ttgctgctcaagttgctgggtgtggacctcctgtggacactggagaaggcccacaagtgg
tgtgaacggccggagtgggtccatattgacacaacaccttttgccagcctgcttcgcaac
ctgggcatcctgtttggactgggcttaggcctcaactccccgatgtatgctgagagctgc
aaagggaagcaaagccaacagctgaccttccgcctcacctgcatcgtttcctccctgttc
atcctccacctgtttgattcctttgaactgcccaccaacagagagatcctcttctacatc
ctctccttctgcaagagtgcttgtgcccatatctgtgcagtggccttgattccctattgt
atctcccagctgctgaaactggcaaggaaaaaagacttatag

DBGET integrated database retrieval system