KEGG   Anolis carolinensis (green anole): 100552812Help
Entry
100552812         CDS       T01608                                 

Gene name
pfkm
Definition
phosphofructokinase, muscle
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100552812 (pfkm)
   01230 Biosynthesis of amino acids
    100552812 (pfkm)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100552812 (pfkm)
   00030 Pentose phosphate pathway
    100552812 (pfkm)
   00051 Fructose and mannose metabolism
    100552812 (pfkm)
   00052 Galactose metabolism
    100552812 (pfkm)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    100552812 (pfkm)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     100552812 (pfkm)
Protein phosphatases and associated proteins [BR:acs01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100552812 (pfkm)
Messenger RNA biogenesis [BR:acs03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     100552812 (pfkm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 782 aa AA seqDB search
MAHVPGKHEHADTMGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGAKVFFVHEGYQGL
VDGGDNIREATWESVSMMLQLGGTVIGSARCKDFRDREGRLKAARNLVKRGITNLCVIGG
DGSLTGADTFRAEWSGLLQDLVKTGGITAEEAKNSSHLNIVGMVGSIDNDFCGTDMTIGT
DSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTALASGADWVFIPESPPEDD
WEEHLCRRLTETRNRGSRLNIIIVAEGAIDKHGKPITSEDIKSLVVKRLGYDTRVTILGH
VQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAIRLPLMECVQVTKDV
TTAMNEGRFDESLKLRGRSFQNNWNVYKILAHVHPPTAKSGYNLAVMNVGAPAAGMNAAV
RSTVRIGLIHGHRMLAVHDGFEGLAEGKVEEIGWSGVGGWTGRGGSSLGTKRTLPKKYFE
EISNTIANFNIHGLIVIGGFEAFTGSLELIEGRAKFEELCIPICVIPATVSNNIPGSDFS
IGADTALNTITSTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIYEDP
FTIRDLELNVSHLTEKMKTTVKRGLILRNEKCNENYTTEFIFNLYSEEGKGIFDTRKNVL
GHMQQGGSPTPFDRNFGTKMGAKAVAWMSGKIKECSRHGRIFANTADSACLLGMRRRALV
FQPLIELKQETDFEHRIPKTQWWLKLRPILKILAKYKIDLDTSETAHLEHITRKRVSGEG
AL
NT seq 2349 nt NT seq  +upstreamnt  +downstreamnt
atggcgcacgttccgggaaaacatgaacatgctgacactatggggatcggcaaggctatt
gccgtgttgacatctggaggagatgcccagggcatgaatgctgctgtccgggctgtagtc
cgagtgggtatatacactggtgccaaagtgttcttcgttcatgagggctaccaaggtctt
gtggatggtggtgacaatattagggaagcaacatgggagagtgtttctatgatgctgcaa
ctgggtggcacagtgatcgggagtgccaggtgcaaggatttccgtgatcgtgaaggacga
ttgaaagctgcacgcaatctagtaaaaagaggaatcacaaacctgtgtgtgattggaggc
gatggcagtttgaccggagcagacaccttccgagcagaatggagtggtttgctgcaggat
ctggttaagacaggtggtatcacagcagaagaagcaaagaactccagtcacctgaacatt
gttggcatggttggctctattgataatgacttttgtggtactgacatgaccattggcaca
gactcagccctccataggataatggagatagtagatgctatcaccaccactgctcaaagc
catcagaggacctttgtgctggaggtgatgggtcgtcactgtggttatctagcccttgta
acagctttggcaagtggagcagactgggttttcattccagaatctccaccagaggatgat
tgggaggaacacttatgcaggaggttaacagagacaagaaatcgaggttcacgactgaac
atcatcattgtagctgaaggagccatcgacaagcatggcaagcccatcacttcagaggac
attaagagtctggttgtgaaacgcctgggctatgacacaagagtcaccatccttggacat
gtgcagcgcggtgggaccccctctgcctttgatcgtatcctgggaagcaggatgggcgtg
gaagccgtcatggccttactagaaggaaccccagataccccagcatgtgttgtcagcctt
tcgggtaaccaagccattcgccttcctctcatggagtgtgtccaagtgacaaaggatgtc
acaacagcaatgaatgaaggacggtttgatgaatctcttaaacttagaggaaggagtttc
cagaataactggaatgtttacaagatcttggctcatgtgcacccacccactgcaaagagt
ggctacaatttggcggtgatgaatgtgggggcaccagcagctggcatgaatgcagccgtg
aggtctactgttagaatcggattgatccatggccacaggatgctggctgtgcatgatggg
tttgaaggccttgctgaaggaaaggttgaagaaattggatggagtggagttggtggctgg
actggaaggggtggatcaagccttggaacgaaaaggacactgcccaagaaatactttgag
gaaatcagcaacacaattgccaattttaatattcatggcctgatcgtcattggtggcttt
gaggctttcactggcagcctggaattgattgaaggccgagccaagtttgaagagctctgc
atcccaatctgtgtgatccctgccaccgtctctaacaacattcctggctctgacttcagc
attggggcagacacagccctcaacaccatcacgtcgacttgtgaccgtatcaagcagtct
gcagctggcaccaagaggcgggtgttcatcattgagaccatgggtggctactgtggctat
ctggctaccatggcaggtttggctgctggagctgatgcagcctacatttatgaagatcct
ttcactatccgtgacctggagttaaatgtgtcacatctgactgaaaaaatgaagaccaca
gtgaagagaggtctgatattgaggaatgagaaatgtaatgaaaactataccactgagttc
atattcaacttgtattctgaggagggaaaaggcatctttgacaccaggaagaatgttttg
ggacacatgcaacagggtggatcgccaactccatttgacaggaactttgggacgaaaatg
ggtgccaaagccgtggcatggatgtctggcaagatcaaagaatgctccagacatggccgt
atttttgccaacactgccgattcagcttgcctcttgggcatgcgcagacgggcacttgtt
ttccagcctctcattgaacttaaacaagagacagattttgagcaccgcatccccaagact
cagtggtggctgaagcttcgtcccatcttgaagattcttgccaaatacaagatcgacttg
gatacctcagagacagcccacctagagcatatcacccgcaagagagtatcaggtgaaggc
gctctgtga

DBGET integrated database retrieval system