KEGG   Anolis carolinensis (green anole): 100552899Help
Entry
100552899         CDS       T01608                                 

Definition
TGF-beta receptor type-2-like
Orthology
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100552899
   04350 TGF-beta signaling pathway
    100552899
   04068 FoxO signaling pathway
    100552899
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100552899
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100552899
  Cell communication
   04520 Adherens junction
    100552899
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100552899
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100552899
Enzyme-linked receptors [BR:acs01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100552899
Cytokine receptors [BR:acs04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100552899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 547 aa AA seqDB search
MDSSGQGQTEKKDEDHLSKLLNGKIKFPTLCKFCDVKLTNCKNEGQCKSHCNLTSICEKK
TEVCAAVWRKNDENITLETICHDPSQKLHGHELTDYNSKKCIMSERRETGGLLYMCSCDE
EECNDVLIFSPENSPTERVIDVISKVALISLVPLLVSAIAVSFIFYCYRIQRRRKLNKAW
EKNVKSRKRKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDTLVGKGRFAEVYK
AKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENILQFLTAEERKTDLGKQ
YWLITAFHSRGNLQEYLIKHVISWEDLWKLGGSLARGIAHLHSDHTPCGRPKTPIVHRDL
KSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESRMNLDNVE
SFKQTDVYSMALVLWELTSRCNGVGEVKDYEPPFGSKVREHPCVESMKDNVLRDRGRPEI
PNSWLNHQGIQKVCETLVECWDHDPEARLTAQCVAERFNDFEYQDTLSGRSSSEEKIPEE
VSVNSAN
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atggacagtagtggacagggccagacagaaaaaaaagatgaagatcatttatccaaactg
ttgaatgggaaaatcaagtttccaacactttgcaaattttgtgatgtgaaattaacaaac
tgcaaaaatgaaggccagtgcaagagtcactgcaacctcacatctatttgcgaaaaaaaa
actgaagtatgtgcagctgtttggagaaaaaatgatgaaaacataacattggaaacaata
tgtcatgatccatcgcaaaagctccatgggcatgaattgacagactacaattcaaagaaa
tgtataatgtcagagaggagggaaactggagggttgctttatatgtgctcctgcgatgag
gaggaatgcaatgatgtacttattttttctccagaaaactcaccaacagagagagtgata
gatgtgatatctaaagttgcactaataagcctcgttccattgcttgtgagtgccattgct
gtgagctttatcttctactgctaccgtattcagaggaggaggaagctgaacaaggcatgg
gagaaaaatgtgaaatccaggaaacgtaaagactgtagcgatgtgtgtgccattatgtta
gatgatgaccgctctgatattagttcgacttgtgccaataacataaaccataatacggaa
ctgttgcccattgaactggataccctggtgggcaaagggcgctttgctgaagtctataag
gctaaattgaaacagaacacatcagagcaatttgagacagtggctgtcaagatcttttcc
tatgaagaatatgcatcctggaagaccgagaaggatatattctccgatataaatctgaaa
catgagaacatcctccagttcctcacagcagaagagcgcaagacggatctaggcaagcaa
tactggttgatcactgctttccactcaaggggcaatttgcaggaatacctcataaaacac
gtaattagctgggaagacctctggaaattgggtggatctttggctcgagggattgcccat
ctccacagtgaccatacaccctgtggccgccccaaaacacctattgtacacagggacctg
aagagctccaatatcttggtgaaaaatgacttaacctgctgcctctgtgattttggactt
tcattgaggctggatcctactctttctgtagatgacctagccaacagtggtcaggtcggc
actgcaagatacatggctcctgaagtcctggaatcacgaatgaatttggataatgttgaa
tccttcaagcagacagatgtgtattccatggccttagttctatgggaactgacatcccgt
tgcaatggtgttggagaggtcaaagactatgagcccccatttggttctaaagtgagagaa
catccttgcgtggaaagcatgaaggacaacgttttgagggacagagggcgaccagagatt
cctaactcatggctcaaccatcagggcatccagaaagtctgtgagactcttgtggagtgc
tgggaccatgaccctgaagcccggctcactgctcagtgcgtagctgagcggttcaatgat
tttgaataccaggacacactttcaggaagaagcagctctgaagagaagatccctgaggag
gtctctgtgaacagtgccaactaa

DBGET integrated database retrieval system