KEGG   Anolis carolinensis (green anole): 100552899Help
Entry
100552899         CDS       T01608                                 

Gene name
tgfbr2
Definition
(RefSeq) transforming growth factor beta receptor 2
  KO
K04388  
TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Adherens junction
AGE-RAGE signaling pathway in diabetic complications
Module
TGF-beta signaling
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100552899 (tgfbr2)
   04350 TGF-beta signaling pathway
    100552899 (tgfbr2)
   04068 FoxO signaling pathway
    100552899 (tgfbr2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100552899 (tgfbr2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100552899 (tgfbr2)
  Cellular community - eukaryotes
   04520 Adherens junction
    100552899 (tgfbr2)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100552899 (tgfbr2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     100552899 (tgfbr2)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: TKL group
  TGFBR2 family [OT]
   100552899 (tgfbr2)
Enzyme-linked receptors [BR:acs01020]
 Receptor serine/threonine kinases
  Type II TGF-beta receptor
   100552899 (tgfbr2)
Cytokine receptors [BR:acs04050]
 TGF-beta receptors
  Type II TGF-beta receptor
   100552899 (tgfbr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 554 aa AA seqDB search
MDGHLWREKSIFHLFFLFPDEDHLSKLLNGKIKFPTLCKFCDVKLTNCKNEGQCKSHCNL
TSICEKKTEVCAAVWRKNDENITLETICHDPSQKLHGHELTDYNSKKCIMSERRETGGLL
YMCSCDEEECNDVLIFSPENSPTERVIDVISKVALISLVPLLVSAIAVSFIFYCYRIQRR
RKLNKAWEKNVKSRKRKDCSDVCAIMLDDDRSDISSTCANNINHNTELLPIELDTLVGKG
RFAEVYKAKLKQNTSEQFETVAVKIFSYEEYASWKTEKDIFSDINLKHENILQFLTAEER
KTDLGKQYWLITAFHSRGNLQEYLIKHVISWEDLWKLGGSLARGIAHLHSDHTPCGRPKT
PIVHRDLKSSNILVKNDLTCCLCDFGLSLRLDPTLSVDDLANSGQVGTARYMAPEVLESR
MNLDNVESFKQTDVYSMALVLWELTSRCNGVGEVKDYEPPFGSKVREHPCVESMKDNVLR
DRGRPEIPNSWLNHQGIQKVCETLVECWDHDPEARLTAQCVAERFNDFEYQDTLSGRSSS
EEKIPEEVSVNSAN
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggatggacacttgtggagggaaaaatctatatttcatctttttttcttatttccagat
gaagatcatttatccaaactgttgaatgggaaaatcaagtttccaacactttgcaaattt
tgtgatgtgaaattaacaaactgcaaaaatgaaggccagtgcaagagtcactgcaacctc
acatctatttgcgaaaaaaaaactgaagtatgtgcagctgtttggagaaaaaatgatgaa
aacataacattggaaacaatatgtcatgatccatcgcaaaagctccatgggcatgaattg
acagactacaattcaaagaaatgtataatgtcagagaggagggaaactggagggttgctt
tatatgtgctcctgcgatgaggaggaatgcaatgatgtacttattttttctccagaaaac
tcaccaacagagagagtgatagatgtgatatctaaagttgcactaataagcctcgttcca
ttgcttgtgagtgccattgctgtgagctttatcttctactgctaccgtattcagaggagg
aggaagctgaacaaggcatgggagaaaaatgtgaaatccaggaaacgtaaagactgtagc
gatgtgtgtgccattatgttagatgatgaccgctctgatattagttcgacttgtgccaat
aacataaaccataatacggaactgttgcccattgaactggataccctggtgggcaaaggg
cgctttgctgaagtctataaggctaaattgaaacagaacacatcagagcaatttgagaca
gtggctgtcaagatcttttcctatgaagaatatgcatcctggaagaccgagaaggatata
ttctccgatataaatctgaaacatgagaacatcctccagttcctcacagcagaagagcgc
aagacggatctaggcaagcaatactggttgatcactgctttccactcaaggggcaatttg
caggaatacctcataaaacacgtaattagctgggaagacctctggaaattgggtggatct
ttggctcgagggattgcccatctccacagtgaccatacaccctgtggccgccccaaaaca
cctattgtacacagggacctgaagagctccaatatcttggtgaaaaatgacttaacctgc
tgcctctgtgattttggactttcattgaggctggatcctactctttctgtagatgaccta
gccaacagtggtcaggtcggcactgcaagatacatggctcctgaagtcctggaatcacga
atgaatttggataatgttgaatccttcaagcagacagatgtgtattccatggccttagtt
ctatgggaactgacatcccgttgcaatggtgttggagaggtcaaagactatgagccccca
tttggttctaaagtgagagaacatccttgcgtggaaagcatgaaggacaacgttttgagg
gacagagggcgaccagagattcctaactcatggctcaaccatcagggcatccagaaagtc
tgtgagactcttgtggagtgctgggaccatgaccctgaagcccggctcactgctcagtgc
gtagctgagcggttcaatgattttgaataccaggacacactttcaggaagaagcagctct
gaagagaagatccctgaggaggtctctgtgaacagtgccaactaa

DBGET integrated database retrieval system