KEGG   Anolis carolinensis (green anole): 100552939Help
Entry
100552939         CDS       T01608                                 

Gene name
adh1a
Definition
(RefSeq) alcohol dehydrogenase 1A
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00010  Glycolysis / Gluconeogenesis
acs00071  Fatty acid degradation
acs00350  Tyrosine metabolism
acs00830  Retinol metabolism
acs00980  Metabolism of xenobiotics by cytochrome P450
acs00982  Drug metabolism - cytochrome P450
acs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100552939 (adh1a)
  Lipid metabolism
   00071 Fatty acid degradation
    100552939 (adh1a)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100552939 (adh1a)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100552939 (adh1a)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100552939 (adh1a)
   00982 Drug metabolism - cytochrome P450
    100552939 (adh1a)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100552939 (adh1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 Glu_dehyd_C UDPG_MGDP_dh_N IGFBP DUF4630
Motif
Other DBs
NCBI-GeneID: 100552939
NCBI-ProteinID: XP_003225784
Ensembl: ENSACAG00000011740
UniProt: H9GIK1
Position
Un
AA seq 376 aa AA seqDB search
MSTAGKVIKCKAAIAWEIKKPLSIEQIEVSPPKAHEVRIKILATGICRSDDHVISGAFAM
PLPMVLGHEAAGVVESVGEGVTCVKPGDKVIPLFVPQCGKCSSCQSTKGNLCTANDLSSG
QGLMPDGTCRFTCKGKSLHHFISTSTFTEYTVVHENAVVKIDDAAPLEKVCLVGCGFSTG
YGAAVQTAKVEPGSTCAVFGLGGVGLSAVMGCKAAGASRIIGVDINKDKFPKAKELGATE
CVNPLDFKKPINEVLFDLTGGEGVDYSFEVIGRIDTMTAALASCHNNYGTSVIVGVPPSA
AQISLDPMLLFTGRTWKGSVFGGWKSKDSVPKLVSDFMGKKFILDPLITHTMPFEKINEG
FELLRSGKSIRTVLTF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgcaggcaaggtcattaaatgcaaagcagcaattgcttgggagattaagaaa
cccctgagcattgaacagatagaagtaagccctccaaaggctcatgaagttcgcattaag
attttggccacagggatatgtcgctcagatgaccatgtgatcagtggtgcttttgctatg
cctttaccaatggttctgggccatgaagcagctggtgttgtggagagcgttggagaggga
gtcacctgtgtaaaaccaggagacaaagtaatcccactctttgttccacagtgtggaaaa
tgcagctcttgccaaagtaccaaaggcaacctctgtactgcaaatgacctcagtagtggt
caaggcttaatgccagatggcacctgcaggttcacctgcaaaggaaagagtcttcaccat
ttcatcagcaccagtaccttcactgaatacactgtggtgcatgaaaatgcagtggtcaag
attgatgatgctgcccctttggaaaaagtatgtctggttggctgtgggttttctactggt
tatggagcagctgttcaaacagcaaaggtggagcctgggtctacctgtgctgtctttggc
ttgggaggagttggtctctcagcagtgatgggttgcaaagcagctggagcatcacgaatc
attggtgtggacatcaacaaggacaaatttcctaaggcgaaagagttgggagccaccgag
tgcgtcaatcccctggatttcaagaagcccatcaatgaagtgctgtttgatttgacaggc
ggagaaggtgtagactattcatttgaagtgattgggcgtatagataccatgactgcagct
ctggcttcttgccacaacaactatgggaccagtgtgattgtgggagtgcctccttcagca
gctcaaatctctttagatccaatgttgcttttcacaggacgtacctggaaaggatcagtc
tttggaggatggaagagcaaggactctgtccctaaactcgtttctgatttcatggggaag
aaattcattttggatccactgataacacacacaatgccttttgagaaaattaatgaagga
tttgaactgctccggtcaggaaagagcatccgcactgtcttgaccttttaa

DBGET integrated database retrieval system