KEGG   Anolis carolinensis (green anole): 100553107Help
Entry
100553107         CDS       T01608                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100553107
Enzymes [BR:acs01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100553107
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100553107
  Exosomal proteins of colorectal cancer cells
   100553107
  Exosomal proteins of bladder cancer cells
   100553107
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 511 aa AA seqDB search
MKTAPLLGLLLLGLACSAADFEEDEGVLVLKTANFEQALEQFPNILVEFYAPWCGHCKAL
APEYAKAAAKLKSENSEIRLAKVDATEESELAQQFGVRGYPTIKFFKNGDKSSPKEYTAG
READDILNWLKKRTGPAATTLKDVAGAEELVEANEVAVIGFFKDAESNAAKQFLLAAESI
DDIPFGISSSSDVFAKYQLSKDGVALFKKFDEGRNNFDGEITKENLLNFIKSNQLPLVIE
FTEQTAPKIFGGEIKTHILLFLPKSDTDYQQKLDNFKKAAESFKGKILFIFIDSDHTDNQ
RILEFFGLKKEECPAIRLITLEEEMTKYKPESDELTPENIRDFCNKFLEGKVKPHLMSQE
ISDDWDKQPVRVLVGKNFEDVAFDETKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHEN
IIIAKMDSTANEVEAVKVHSFPTLKFFPAGPGRTVVDYNGERTLEGFKKFLESGGKDGGV
DEDDLEDLEDMEEPDAEGEEEEDATLKKDEL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgctccgctcctgggcctcctcttgctgggcctggcctgctccgccgccgac
ttcgaggaggacgagggcgtcctggtgctgaagacggccaacttcgagcaggcgctggag
cagttccccaacatcctggtggagttctatgcaccatggtgtggccactgtaaagctctg
gcaccggagtatgcaaaggcagcagctaaactgaaatctgagaactctgaaatcaggctg
gctaaggtggatgccacagaagagtcagaacttgcccagcagtttggtgtgcgaggatat
cccactattaagttttttaagaacggagataaatcttccccgaaagaatacacagctggc
agggaagcggatgacattctgaactggttgaagaagcgcacagggccagcagccactaca
ctgaaggatgttgcaggagctgaagaacttgtggaagccaatgaagttgctgtgattggg
ttctttaaggatgcagagtctaatgctgccaaacaattcttgttggcagcagagtccatc
gatgacattccttttgggatttcctccagcagcgatgtctttgccaaataccagctcagc
aaagatggggttgctctttttaagaagtttgatgaaggccgtaacaactttgatggggag
ataacaaaggagaacctgttgaacttcatcaaatcaaaccagttgcccttggtgattgaa
tttactgaacagactgcacccaaaatctttggaggagagatcaaaactcacatccttctg
ttcctacccaagagtgatacagactaccaacaaaaactggataacttcaaaaaagctgca
gagagcttcaaagggaagattttgtttatctttatagacagtgaccacactgataaccag
aggatcttggagttctttggcctgaagaaagaggagtgccctgccatacgcctcattact
cttgaggaagaaatgactaagtataaacctgagtcagatgaactgactccagaaaacatc
agggatttctgcaacaagttcctggagggcaaagttaagccccatctgatgagccaagag
atttctgatgactgggataaacaacctgtcagagttctggttgggaagaactttgaggat
gtggcttttgatgagactaagaatgtctttgtcgaattctatgctccctggtgtggccac
tgcaaacaattggctcccatttgggataaactcggggagacttacaaggaccatgaaaac
attatcatagccaagatggattctacagccaatgaggttgaggcagtaaaggtccacagc
ttccctactctcaagtttttccctgctggtcctggcagaacggttgtagactacaatggt
gagaggacactggagggcttcaagaaattcctggaaagtggtggaaaagatggtggcgta
gacgaagatgatctggaagatctagaggatatggaagagccagatgctgaaggggaggaa
gaggaggatgctacacttaaaaaagatgaactgtaa

DBGET integrated database retrieval system