KEGG   Anolis carolinensis (green anole): 100553107Help
Entry
100553107         CDS       T01608                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:acs04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 511 aa AA seqDB search
MKTAPLLGLLLLGLACSAADFEEDEGVLVLKTANFEQALEQFPNILVEFYAPWCGHCKAL
APEYAKAAAKLKSENSEIRLAKVDATEESELAQQFGVRGYPTIKFFKNGDKSSPKEYTAG
READDILNWLKKRTGPAATTLKDVAGAEELVEANEVAVIGFFKDAESNAAKQFLLAAESI
DDIPFGISSSSDVFAKYQLSKDGVALFKKFDEGRNNFDGEITKENLLNFIKSNQLPLVIE
FTEQTAPKIFGGEIKTHILLFLPKSDTDYQQKLDNFKKAAESFKGKILFIFIDSDHTDNQ
RILEFFGLKKEECPAIRLITLEEEMTKYKPESDELTPENIRDFCNKFLEGKVKPHLMSQE
ISDDWDKQPVRVLVGKNFEDVAFDETKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHEN
IIIAKMDSTANEVEAVKVHSFPTLKFFPAGPGRTVVDYNGERTLEGFKKFLESGGKDGGV
DEDDLEDLEDMEEPDAEGEEEEDATLKKDEL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagaccgctccgctcctgggcctcctcttgctgggcctggcctgctccgccgccgac
ttcgaggaggacgagggcgtcctggtgctgaagacggccaacttcgagcaggcgctggag
cagttccccaacatcctggtggagttctatgcaccatggtgtggccactgtaaagctctg
gcaccggagtatgcaaaggcagcagctaaactgaaatctgagaactctgaaatcaggctg
gctaaggtggatgccacagaagagtcagaacttgcccagcagtttggtgtgcgaggatat
cccactattaagttttttaagaacggagataaatcttccccgaaagaatacacagctggc
agggaagcggatgacattctgaactggttgaagaagcgcacagggccagcagccactaca
ctgaaggatgttgcaggagctgaagaacttgtggaagccaatgaagttgctgtgattggg
ttctttaaggatgcagagtctaatgctgccaaacaattcttgttggcagcagagtccatc
gatgacattccttttgggatttcctccagcagcgatgtctttgccaaataccagctcagc
aaagatggggttgctctttttaagaagtttgatgaaggccgtaacaactttgatggggag
ataacaaaggagaacctgttgaacttcatcaaatcaaaccagttgcccttggtgattgaa
tttactgaacagactgcacccaaaatctttggaggagagatcaaaactcacatccttctg
ttcctacccaagagtgatacagactaccaacaaaaactggataacttcaaaaaagctgca
gagagcttcaaagggaagattttgtttatctttatagacagtgaccacactgataaccag
aggatcttggagttctttggcctgaagaaagaggagtgccctgccatacgcctcattact
cttgaggaagaaatgactaagtataaacctgagtcagatgaactgactccagaaaacatc
agggatttctgcaacaagttcctggagggcaaagttaagccccatctgatgagccaagag
atttctgatgactgggataaacaacctgtcagagttctggttgggaagaactttgaggat
gtggcttttgatgagactaagaatgtctttgtcgaattctatgctccctggtgtggccac
tgcaaacaattggctcccatttgggataaactcggggagacttacaaggaccatgaaaac
attatcatagccaagatggattctacagccaatgaggttgaggcagtaaaggtccacagc
ttccctactctcaagtttttccctgctggtcctggcagaacggttgtagactacaatggt
gagaggacactggagggcttcaagaaattcctggaaagtggtggaaaagatggtggcgta
gacgaagatgatctggaagatctagaggatatggaagagccagatgctgaaggggaggaa
gaggaggatgctacacttaaaaaagatgaactgtaa

DBGET integrated database retrieval system