KEGG   Anolis carolinensis (green anole): 100553164Help
Entry
100553164         CDS       T01608                                 

Definition
mitogen-activated protein kinase kinase kinase 12-like
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:acs04010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 879 aa AA seqDB search
MACLHETRTPSPSFGSFNTILAESSLRKLDPDASDCTPEKDLTPTQCVLRDVLPIDGGGG
GGGGHSPTPSEETHDQFANSVLQLHENEAGGHGGGSGAGAGAGAGNPEVRATRYHADQVR
LHCQSGSGFLEGLFGCLKPVWTMIGKAYSTEHKQQQEDPWEVPFEEIMDLQWVGSGAQGA
VFLGRFHGEEVAVKKVRDFKETDIKHLRKLKHPNIITFKGVCTQAPCYCIIMEFCAQGQL
YEVLRAGRKVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTS
KELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAI
IWGVGSNSLHLPVPTSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQET
YFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELIHRRREELRHALDIREHYERKLERANN
LYMELNSLMLQLELKEKELLRREQALEKKYPGLFKHHPSRSLLHGNTVEKLIKKRNVPQK
LSPHSKRPDILKTEVIMDPTLPQLAIPVCQKGPPSPGRSRRAKSRYRKVSSRGSCGELAE
PAGAKRLEPCAALRGLQHDLLLRKMSSSSPDLISTTLGAESRKGETGPESPPTEQPRSET
PSEDTASVPCSSSPESPSSRQGAVGPPGKARLQPGEEAERDQGRSSRAGAASQSQHLTPA
ALLYRAAVTRSQKRGVSSEEEEGEVDSEVELPLRQRWPQAMSKRQSLSTFSSENFSDADG
EEGTASEGTTASHSGGTPDVASTNTDERLDAERSDDDILGHSDGLSEKEAAIRLVKRQLS
AEQNGGEDPTAYEDSDCDIAELDHSGSGEVQRLPDMPNL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctgcacgagacccgcacaccttccccctcctttggcagtttcaacactatc
ctagcggagagttccctccgaaaattggacccggatgcttcagactgcaccccggaaaag
gaccttacgccgacgcagtgtgtgttgagggatgtgcttcccatcgatggcggaggagga
ggtggaggggggcacagccctactcccagcgaagagacccacgaccagtttgccaacagt
gtcctgcagctccacgaaaatgaagctggaggtcatggaggaggaagtggggcaggcgca
ggggccggggctggcaatccggaggtgcgggccacccgctaccatgctgaccaggttcgg
ctccactgccagtctggaagcggcttcctggaaggcctcttcggttgcctgaagcccgtc
tggaccatgattggcaaagcgtattccactgaacacaaacagcaacaggaagatccttgg
gaagtgccctttgaagagatcatggacttgcagtgggtgggcagtggggcacagggggct
gtcttcctgggacgcttccatggggaggaggtggctgtcaagaaggtgcgagacttcaag
gagacagacatcaagcacctgcggaagctgaaacatcccaacatcattaccttcaagggt
gtttgtacccaggctccctgctactgcatcatcatggagttctgtgcccagggccaactg
tatgaggtgctgcgagccgggcgcaaggtcacaccctccctgttggtcgactggtctatg
ggtattgccggcggcatgaattacctgcacctccataagatcatccaccgtgacctcaag
tcacccaacatgttgataacttacgacgatgtggtgaagatctctgatttcggtacctcc
aaagagctcagtgacaagagcaccaagatgtcctttgccggcacagtggcctggatggca
ccagaagtcattcggaatgaacctgtttctgagaaggttgacatctggtccttcggcgtt
gttctctgggagttgctaacaggagaaatcccttacaaggacgtggattcctcagccata
atctggggtgtaggcagtaacagcctccacctgcctgtgcccaccagctgccctgatggt
ttcaagatcttgctaagacagtgctggaatagcaaacctcggaaccgtccgtctttccgc
cagatcctgctgcaccttgacattgcgtcagctgacgttctctctacgccgcaggagacc
tacttcaaatcccaggctgaatggcgggaggaagtaaaactacattttgaaaagattaaa
tcagagggaacatgtctacaccgcttggaggaggagttgatccaccgacggcgagaagaa
ctcaggcacgctttggacatccgggagcactacgagagaaagctggagcgggccaacaat
ctttatatggagctcaattccctgatgttacagctggagctcaaagagaaggagctgctc
cggcgggagcaagctctggagaagaaatatcctgggctctttaaacaccatccatcccgg
agcctcctccatggcaacacagtggaaaagctgatcaagaagaggaacgtgcctcagaag
ctctctccgcacagcaagaggcctgacattctgaagacagaggtgatcatggacccaact
ctgccccagcttgccatccccgtgtgccagaagggccctccatccccggggcgcagtcgc
cgagctaagtcacgctaccgcaaggtcagctcccggggcagttgtggggagctggctgaa
cctgcgggagccaagcgcctggagccctgtgctgcgctgcgaggccttcagcacgacctc
ctcctccgcaagatgtcgtcttccagccctgacctcatctccacgactctgggggccgag
agccgcaaaggggaaaccgggcccgaatccccaccgacggagcagccccgcagcgaaact
cccagtgaagataccgcctcggtgccgtgctccagcagccccgagtctccctcttcccga
cagggtgctgtagggccaccgggaaaggcgaggctgcagccgggagaagaggctgagcgg
gaccagggccgaagcagtcgagccggggccgcctctcaatcccagcatctcacgccagca
gctctcttgtatcgggcagctgtcactcggagccagaagcgtggggtctcctcagaggag
gaggaaggggaggtggacagtgaagtcgagcttccactccggcaaaggtggcctcaggcc
atgagcaagcggcagtcactctctactttcagctctgagaatttctccgatgcggatggc
gaagagggcactgccagcgagggcaccacggcttcccacagcggtggcacaccagacgtg
gccagcaccaatacagacgagcggctggacgcagagcgctcagatgacgatatcctgggt
cactcggatgggctgtctgaaaaggaggcggccatccgtcttgtcaaacgccaactcagt
gctgagcagaatggaggggaggaccctactgcctatgaggattctgactgcgacattgcc
gaactggaccattcaggcagtggagaggtgcagagacttccagacatgcccaatttgtga

DBGET integrated database retrieval system