KEGG   Anolis carolinensis (green anole): 100553164Help
Entry
100553164         CDS       T01608                                 

Gene name
map3k12
Definition
mitogen-activated protein kinase kinase kinase 12
Orthology
K04423  
mitogen-activated protein kinase kinase kinase 12 [EC:2.7.11.25]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100553164 (map3k12)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100553164 (map3k12)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: TKL group
  MLK family
   100553164 (map3k12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 879 aa AA seqDB search
MACLHETRTPSPSFGSFNTILAESSLRKLDPDASDCTPEKDLTPTQCVLRDVLPIDGGGG
GGGGHSPTPSEETHDQFANSVLQLHENEAGGHGGGSGAGAGAGAGNPEVRATRYHADQVR
LHCQSGSGFLEGLFGCLKPVWTMIGKAYSTEHKQQQEDPWEVPFEEIMDLQWVGSGAQGA
VFLGRFHGEEVAVKKVRDFKETDIKHLRKLKHPNIITFKGVCTQAPCYCIIMEFCAQGQL
YEVLRAGRKVTPSLLVDWSMGIAGGMNYLHLHKIIHRDLKSPNMLITYDDVVKISDFGTS
KELSDKSTKMSFAGTVAWMAPEVIRNEPVSEKVDIWSFGVVLWELLTGEIPYKDVDSSAI
IWGVGSNSLHLPVPTSCPDGFKILLRQCWNSKPRNRPSFRQILLHLDIASADVLSTPQET
YFKSQAEWREEVKLHFEKIKSEGTCLHRLEEELIHRRREELRHALDIREHYERKLERANN
LYMELNSLMLQLELKEKELLRREQALEKKYPGLFKHHPSRSLLHGNTVEKLIKKRNVPQK
LSPHSKRPDILKTEVIMDPTLPQLAIPVCQKGPPSPGRSRRAKSRYRKVSSRGSCGELAE
PAGAKRLEPCAALRGLQHDLLLRKMSSSSPDLISTTLGAESRKGETGPESPPTEQPRSET
PSEDTASVPCSSSPESPSSRQGAVGPPGKARLQPGEEAERDQGRSSRAGAASQSQHLTPA
ALLYRAAVTRSQKRGVSSEEEEGEVDSEVELPLRQRWPQAMSKRQSLSTFSSENFSDADG
EEGTASEGTTASHSGGTPDVASTNTDERLDAERSDDDILGHSDGLSEKEAAIRLVKRQLS
AEQNGGEDPTAYEDSDCDIAELDHSGSGEVQRLPDMPNL
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atggcatgcctgcacgagacccgcacaccttccccctcctttggcagtttcaacactatc
ctagcggagagttccctccgaaaattggacccggatgcttcagactgcaccccggaaaag
gaccttacgccgacgcagtgtgtgttgagggatgtgcttcccatcgatggcggaggagga
ggtggaggggggcacagccctactcccagcgaagagacccacgaccagtttgccaacagt
gtcctgcagctccacgaaaatgaagctggaggtcatggaggaggaagtggggcaggcgca
ggggccggggctggcaatccggaggtgcgggccacccgctaccatgctgaccaggttcgg
ctccactgccagtctggaagcggcttcctggaaggcctcttcggttgcctgaagcccgtc
tggaccatgattggcaaagcgtattccactgaacacaaacagcaacaggaagatccttgg
gaagtgccctttgaagagatcatggacttgcagtgggtgggcagtggggcacagggggct
gtcttcctgggacgcttccatggggaggaggtggctgtcaagaaggtgcgagacttcaag
gagacagacatcaagcacctgcggaagctgaaacatcccaacatcattaccttcaagggt
gtttgtacccaggctccctgctactgcatcatcatggagttctgtgcccagggccaactg
tatgaggtgctgcgagccgggcgcaaggtcacaccctccctgttggtcgactggtctatg
ggtattgccggcggcatgaattacctgcacctccataagatcatccaccgtgacctcaag
tcacccaacatgttgataacttacgacgatgtggtgaagatctctgatttcggtacctcc
aaagagctcagtgacaagagcaccaagatgtcctttgccggcacagtggcctggatggca
ccagaagtcattcggaatgaacctgtttctgagaaggttgacatctggtccttcggcgtt
gttctctgggagttgctaacaggagaaatcccttacaaggacgtggattcctcagccata
atctggggtgtaggcagtaacagcctccacctgcctgtgcccaccagctgccctgatggt
ttcaagatcttgctaagacagtgctggaatagcaaacctcggaaccgtccgtctttccgc
cagatcctgctgcaccttgacattgcgtcagctgacgttctctctacgccgcaggagacc
tacttcaaatcccaggctgaatggcgggaggaagtaaaactacattttgaaaagattaaa
tcagagggaacatgtctacaccgcttggaggaggagttgatccaccgacggcgagaagaa
ctcaggcacgctttggacatccgggagcactacgagagaaagctggagcgggccaacaat
ctttatatggagctcaattccctgatgttacagctggagctcaaagagaaggagctgctc
cggcgggagcaagctctggagaagaaatatcctgggctctttaaacaccatccatcccgg
agcctcctccatggcaacacagtggaaaagctgatcaagaagaggaacgtgcctcagaag
ctctctccgcacagcaagaggcctgacattctgaagacagaggtgatcatggacccaact
ctgccccagcttgccatccccgtgtgccagaagggccctccatccccggggcgcagtcgc
cgagctaagtcacgctaccgcaaggtcagctcccggggcagttgtggggagctggctgaa
cctgcgggagccaagcgcctggagccctgtgctgcgctgcgaggccttcagcacgacctc
ctcctccgcaagatgtcgtcttccagccctgacctcatctccacgactctgggggccgag
agccgcaaaggggaaaccgggcccgaatccccaccgacggagcagccccgcagcgaaact
cccagtgaagataccgcctcggtgccgtgctccagcagccccgagtctccctcttcccga
cagggtgctgtagggccaccgggaaaggcgaggctgcagccgggagaagaggctgagcgg
gaccagggccgaagcagtcgagccggggccgcctctcaatcccagcatctcacgccagca
gctctcttgtatcgggcagctgtcactcggagccagaagcgtggggtctcctcagaggag
gaggaaggggaggtggacagtgaagtcgagcttccactccggcaaaggtggcctcaggcc
atgagcaagcggcagtcactctctactttcagctctgagaatttctccgatgcggatggc
gaagagggcactgccagcgagggcaccacggcttcccacagcggtggcacaccagacgtg
gccagcaccaatacagacgagcggctggacgcagagcgctcagatgacgatatcctgggt
cactcggatgggctgtctgaaaaggaggcggccatccgtcttgtcaaacgccaactcagt
gctgagcagaatggaggggaggaccctactgcctatgaggattctgactgcgacattgcc
gaactggaccattcaggcagtggagaggtgcagagacttccagacatgcccaatttgtga

DBGET integrated database retrieval system