KEGG   Anolis carolinensis (green anole): 100553167Help
Entry
100553167         CDS       T01608                                 

Gene name
sphk1
Definition
(RefSeq) sphingosine kinase 1
  KO
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Apelin signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100553167 (sphk1)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100553167 (sphk1)
   04371 Apelin signaling pathway
    100553167 (sphk1)
   04020 Calcium signaling pathway
    100553167 (sphk1)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100553167 (sphk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 550 aa AA seqDB search
MERRASAAPCEEGEDSEEVLLSGVFSLAPDPQPNYALSLTKDAQLRVRRLDGPAGGGSSS
SSSSGTTSSSSWSVCLSECVGCQAVQSPGAPQPPPAAFFTLFLYPARKGCCWWDASTSRQ
RLVRTFGACVSREPAENRRLAETWAREIRRLAAPRPPPRPGVTYGLLPRPCRVMVLLNPQ
SGSGRAPCLFRCHVQPMLKEANIGFDLFVTERRNYAWDMVKEKDLSRWDALVVMAGDGLL
YEVINGLMERPDWKSVIQKPLCILPGGSGNALAASLNHYVGKGSFAKEDLLMNCTYFLCK
GLYAPMDLVSLRTASGKHLFSFLSFGWGFVSDVDIASERYRKLGSIRFTVGTFQLLASLQ
VYKGRISYLPAEDQSFTSDSSFPPGAQNDTSAQDAAQMLSNNILSPSVPALPSQDSVLED
SLLVPLEQPVPQHWTVAPQEEFVSIIAIFQSHLGADLLLAPSAKLYDDAIHLFYLTAGVS
RMAMIKFFMAMDKGTHLSLNNPHLHYVPVKAFRVEPFESKGVMTVDGEVLACEPVQGQIH
RQLARIITGS
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atggagcgcagggcaagcgccgctccttgcgaggaaggagaagacagcgaggaagttttg
ctctcgggggtcttctcgctcgcgccggacccgcagcccaactacgccctgagcctcacc
aaggacgcccagctccgcgtgcgaaggctggacggacccgccggcggcggcagtagcagc
agcagcagtagcggtactacctcttcgtcctcgtggagcgtgtgcctgtcggagtgcgtg
ggctgccaggcggtgcagagccccggcgccccgcagccgcccccggccgccttcttcacg
ctcttcctctacccggccaggaagggctgctgctggtgggacgcctccacctcgcggcaa
cgcctcgtgcgcaccttcggcgcctgcgtctcccgcgagcccgccgagaaccggcgcctg
gccgagacctgggcccgcgagatccggcgcctggccgcccccaggccgcccccgagacca
ggagtaacatatggcctcctccctcgaccctgtcgagtgatggttctgctgaatccacag
agcggatcaggccgggctccatgcctgttcagatgccatgtccagccaatgctgaaggaa
gccaacattggatttgacctgtttgtaactgagaggcgcaactatgcttgggatatggtg
aaagagaaagacttgtccaggtgggatgccttggtggtgatggctggagatggcttactg
tatgaggtgatcaatggactgatggagcgtcctgactggaagtctgtgatccagaagcct
ctttgtatcctcccaggaggctctgggaatgccctggcagcttctctaaatcattatgtg
ggcaagggcagctttgccaaagaagatctgctaatgaactgcacatactttctatgcaaa
ggcctgtatgctcctatggacttggtgtccctacgcacagcttcagggaagcacctcttc
tccttccttagctttggctggggtttcgtctctgatgtggacattgccagtgaaagatat
cgtaaactaggaagtatccgcttcactgtgggcacattccagcttctggcctcactccag
gtttacaagggccgcatttcatacctgccggctgaagatcaaagcttcacctcagactcc
tcatttcctcctggagcacagaatgacacatcagctcaggatgcagcccagatgctttcc
aacaacatcctgtccccaagcgtgcctgccctccctagccaggactctgtgcttgaggac
tccctgttggtacctttggagcaaccggttcctcagcactggactgtagcacctcaggag
gagtttgtctccatcatagctatctttcagtcgcacctgggagcagacctccttctagcc
ccttcagccaagctgtatgatgatgcaattcaccttttctatttgactgctggcgtctcc
aggatggccatgatcaagttcttcatggccatggacaaaggaacacacctgtctctcaac
aacccccacctccactatgtgcctgtgaaagcttttcgggtagagcccttcgagtccaag
ggcgtcatgacagtggatggtgaagtattggcatgtgaacccgtacaaggccaaattcat
agacaacttgcacgtatcatcacaggctcctga

DBGET integrated database retrieval system