KEGG   Anolis carolinensis (green anole): 100553287Help
Entry
100553287         CDS       T01608                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial-like
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100553287
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100553287
  Amino acid metabolism
   00310 Lysine degradation
    100553287
Enzymes [BR:acs01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     100553287
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 458 aa AA seqDB search
MLFLSLARARCFSRLLGRSLCAPRQGNCPQGKRSLSGVSRCQGLAYANSRKHLVNSSRVF
TVRYFRSTAACREEVVTVNTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQV
PAPAAGVIEALLVPDGGKVEGGTPLFKLRKGGAAPAKAKPAAAPAPEPAAAPAPPIAPAA
PIPTAMPPVPPVSAVPVDAKPVSAVKPTAAPAAAPAEPGVSKGARLEQRVKMNRMRQRIA
QRLKEAQNTCAMLTTFNEIDMSNIQEMRARHRDSFLKKHNMKLGFMSAFVKASAFALQEQ
PVVNAVIDDTTKEIVYREYVDISVAVATPRGLVVPVIRNVDTMNFADIERAINELGEKAR
KNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPM
MFVALTYDHRLIDGREAVTFLRKIKAVVEDPRVLLLDL
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atgttgttcctctctctggctcgggctcgttgcttcagccggctgctgggccgctcgctc
tgcgctccgcgacagggaaactgtccacagggaaaacgttcactctctggtgtctctcga
tgccaggggctggcttatgccaacagtaggaagcatttggtaaatagctcccgtgtgttc
actgtccgttatttcagaagcaccgcagcatgtcgggaggaagttgttacagtgaacaca
ccggcgtttgcagaatcagtcacagagggagatgtcaggtgggagaaagctgtgggagac
acagtagcagaagatgaagtggtgtgtgagattgaaacagacaagacatctgtgcaggtt
ccagctccagcagctggtgtaattgaagcacttcttgtccctgatggagggaaagtcgaa
ggaggtacacctttgtttaaactcaggaaaggtggagctgcacctgccaaggccaaacca
gcagcagcccctgcaccagagcctgctgcagcacctgcaccaccaattgcccctgcagca
ccaattcccaccgcaatgcctccagtgccccctgtgtcagcagtccctgttgatgctaaa
ccagtgtctgcagtaaagccaactgcagctccagcagctgctcctgcggaacctggggtc
agcaaaggtgccaggttggaacaaagggtgaagatgaatcggatgcgtcagcgcatagcc
cagcgcctgaaagaagctcaaaatacatgtgccatgctgactacattcaatgaaattgat
atgagtaacatccaggaaatgagagcccgacacagggacagtttcctaaagaagcacaat
atgaaacttggatttatgtctgcctttgtgaaagcttcagcctttgccctgcaagagcaa
cccgttgtaaatgcagtgattgatgatacaaccaaagagattgtatacagggaatatgtg
gatatcagtgttgcagttgcaactccaaggggtctcgtagtccctgtcatcagaaatgta
gacacaatgaattttgctgatattgaaagagcaatcaatgaactgggagaaaaggcccgc
aagaacgagcttgccattgaagacatggatggtggtacattcactatcagcaatggtggt
gtattcggatcactttttggaacgcccattatcaacccacctcagtctgctattctgggg
atgcacggcatctttgacaggcctgttgctattggaggcaaggttgaggtgcgaccaatg
atgtttgtggccctgacatatgaccaccgtttgattgatggcagagaggcagtgactttc
ctgcgtaagatcaaggccgtggtggaagaccctcgtgtgctgttgcttgacctgtaa

DBGET integrated database retrieval system