KEGG   Anolis carolinensis (green anole): 100553341Help
Entry
100553341         CDS       T01608                                 

Gene name
stambp
Definition
STAM binding protein
Orthology
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100553341 (stambp)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100553341 (stambp)
Peptidases [BR:acs01002]
 Metallo Peptidases
  Family M67
   100553341 (stambp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 420 aa AA seqDB search
MPDHADASLPPEDRVRGLVQMGSNVEVNEDVPPRRYYRSGVELIRMANIYSEEGNIERAF
ILYNKYITLFIEKLPKHREYKTAVIPEKRETVKKLKEVAFPRAEELKKDLIEKYSKEYEE
YSIRKKKQEEEFARSLALQQQLEEEKQRVALMKQQQAEQEQFQAFEEMIRRQELEKERLR
ILQQFGGPGPEPSVQDAPLIPGAPRPPTDPQVQPPSSGGGVILPKPPAVDRSLKPGTLSS
LHSDAAIEGLRQVIVPRELCHRFLQLADANTARGIETCGILCGKLMQNEFTITHVIVPKQ
TGGPDYCNTENEEELFLIQDQYSLITLGWIHTHPTQTAFLSSVDLHTHCSYQMMLAESIA
IVCSPKYQETGFFKLTEHGMEEISSCRQKGFHPHSKDPPLFTTCTHVSILERDVVVLDLR
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccatgcggacgccagcctgcccccagaggacagggtccggggcctcgtccaa
atggggagcaatgtggaggtgaacgaggatgtccctccacggaggtactaccgctccggc
gtggaactcatccggatggcgaacatctattcggaggaaggcaacatcgaacgtgccttt
atattgtacaacaaatacatcacgcttttcattgaaaaactccccaaacaccgcgaatac
aaaactgctgtcattccagaaaagagagaaacagttaaaaaactaaaagaggttgccttt
ccaagagcagaagagctgaagaaggatctcatagagaagtacagcaaagaatatgaagaa
tatagcatacgtaagaagaagcaagaggaggagtttgctcggagcctggctcttcagcag
cagctggaggaagagaagcagagggtggccctgatgaagcagcagcaggctgagcaggag
cagttccaggcctttgaggagatgatccggcgccaggagctggagaaggagcggctgagg
atcctgcagcagtttggggggccggggccagagccttctgtgcaggatgcccccctgatc
cccggggcccccaggccccccacggacccccaggtccagccacccagcagcggaggagga
gtcatcctgcccaaaccgcctgcagtggaccggtctctgaagcctggaaccttgagcagc
ctgcacagtgatgcagccatagaaggccttcgccaggtcatcgtccccagggagctctgc
catagattcctccagctggccgatgccaacaccgcgaggggcatagagacctgtgggatc
ctttgcgggaagctgatgcagaacgagttcaccatcacccatgtcattgtccccaagcag
accggtggccccgactattgcaacacggagaacgaagaggagctcttcctcatccaggat
caatacagcttgatcaccttgggatggatccatacgcacccgacccaaacggccttcctc
tccagcgtggacctgcacacgcactgctcctaccagatgatgctggcggagtccattgct
attgtctgctcaccaaagtaccaagagacggggttctttaaactgacagagcacggcatg
gaggagatttcttcttgtcggcagaaggggttccatccgcacagcaaagaccctcccctc
ttcactacttgcacccacgtgagcatcctggagcgagacgtggtggttctggaccttcgg
tag

DBGET integrated database retrieval system