KEGG   Anolis carolinensis (green anole): 100553418Help
Entry
100553418         CDS       T01608                                 

Gene name
chrm4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
acs  Anolis carolinensis (green anole)
Pathway
Neuroactive ligand-receptor interaction
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100553418 (chrm4)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100553418 (chrm4)
G protein-coupled receptors [BR:acs04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Acetylcholine (muscarinic) [OT]
    100553418 (chrm4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 497 aa AA seqDB search
MGSGNATDKRWDMAESAYNFSSQPGLMKMANFTNDNITEEGTAKYKTVEMVFIATVTGSL
SLVTVVGNILVMLSIKVNRQLQTVNNYFLFSLACADLIIGVFSMNLYTVYIIKGYWPLGA
VVCDLWLALDYVVSNASVMNLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAVAWILSFI
LWAPAILFWQFIVGKRTVPEGQCYIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLAS
RSRVRRHRPESKKEKRSKPLSFLKTPLVKQNNNNSPKKAVEVKEVKNGKVEEQPLQPSET
TGHQEEKETSNESSTVSITQTNKEKQALEIVPADQGQSPAPPRINPASKWSKIKIVTKQT
GSECVTAIEIVGEKEASSNAITLANSRPANVARKFASIARSQVRKKRQMAAREKKVTRTI
FAILLAFILTWTPYNVMVLINTFCDYCIPDTVWSIGYWLCYVNSTINPACYALCNATFKK
TFKHLLMCQYRNIGTAR
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgggctccggcaacgccaccgacaagcgctgggacatggcggagtctgcatacaacttc
tcttctcagcctggcctgatgaagatggccaacttcaccaatgacaacatcactgaagaa
ggcaccgccaaatataaaactgtggagatggtctttatagccacagtcactggctcgctg
agccttgtcactgtggtgggaaatatcttagtcatgctgtccatcaaagtcaaccgtcaa
ctccagactgtcaataactacttcctttttagtttggcctgtgcagacctgataattgga
gtcttctccatgaatctctacacagtctatattatcaagggctattggccacttggggct
gtggtatgtgacctctggctggccctggactatgtggtgagcaatgcctctgtcatgaac
ttactcataatcagttttgaccgctacttttgtgtcaccaagccactgacctacccagct
agacggacaactaaaatggcagggttaatgattgcagttgcttggatattatcctttatc
ctctgggcccctgccatattattttggcagttcattgttgggaagaggacagttccagaa
gggcagtgttacatacagttcctctccaacccagcggtaacctttggcaccgccattgcg
gctttctacctcccagtggtcatcatgactgtgctttacatccacatctcgctggctagc
cggagccgtgtgaggaggcacaggcctgagagcaagaaggagaagaggtctaagccacta
agttttttgaagaccccactagttaagcagaataacaacaacagtccaaaaaaagcagta
gaagtgaaggaggtgaaaaatgggaaagtagaagagcagcccttacaaccctcagagact
actggacatcaagaagagaaagagacctccaatgaatccagcacagtaagcatcactcag
actaataaagagaagcaggcactggaaattgtgccagctgaccaaggacaaagcccagct
cctccaaggatcaaccctgcctctaagtggtcaaaaattaagattgtcactaagcaaact
ggttcagagtgtgtcacagccattgagattgtgggagaaaaagaagccagttccaatgca
attactttggcaaacagccgtccggctaatgtagccaggaaatttgctagcatcgccagg
agtcaggtccggaagaagcgccaaatggcagctcgggagaagaaggtcaccagaaccatc
tttgccatcttgcttgccttcatcctgacatggacgccttacaatgtgatggtcctcatt
aataccttctgtgattattgcatccctgatacagtctggtccattgggtattggttgtgc
tatgtcaatagcaccattaaccctgcttgctatgccctttgcaatgccacattcaagaaa
acctttaagcaccttctcatgtgtcagtacaggaacatcggcacagcgagataa

DBGET integrated database retrieval system