KEGG   Anolis carolinensis (green anole): 100553424Help
Entry
100553424         CDS       T01608                                 

Gene name
ugp2
Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of antibiotics
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100553424 (ugp2)
   00052 Galactose metabolism
    100553424 (ugp2)
   00500 Starch and sucrose metabolism
    100553424 (ugp2)
   00520 Amino sugar and nucleotide sugar metabolism
    100553424 (ugp2)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100553424 (ugp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 508 aa AA seqDB search
MSSFAKDFSKAMSQAGTSPFQEAIRQELEYSMKVELDKILATAPQNELPHTKKDLEGFKK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDSIASVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYSH
SRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDNFI
DEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEN
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWVSLSAIKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFDNSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVALKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcttttgcaaaagattttagcaaagcaatgtctcaggccggtacttccccattc
caggaagcaattagacaagaactggaatattccatgaaagtggaattggacaaaattctt
gcaactgcaccacagaatgaactgccgcacactaagaaggacctggaagggtttaaaaag
ctctttcatagattcttacaagaaaagggaccttctgtggactggggaaagatccagaga
cctccagaagactctatacagccctatgagaagataaaagccagaggtttgccagatagc
attgcttcagttttgaacaaactggttgtagtgaaactcaatggcggcttgggcaccagt
atgggatgcaagggccccaaaagccttattggggtgcggaatgagaataccttcctggat
ttgactgttcagcagatcgagcatctaaataaaacatacaatacagatgttccactagtt
ctaatgaactccttcaacactgacgaagacaccaaaaagatcttgcaaaaatacagccac
agtcgtgtgaaaatctacactttcaaccaaagcaggtacccacgcattaataaggaatct
ttactgccaatagcaaaagacgtgtcttactctggagagaatacagaggcttggtatcct
ccagggcatggtgacatctatgcaagtttctacaattctggattgctggataattttatt
gatgaggggaaggagtatatttttgtgtccaacatcgataaccttggtgccaccgttgat
ctctacattctcaaccacctcatgaatccgccaaatggaaaacggtgtgaatttgttatg
gaggtcaccaataaaacaagggcagatgttaagggcggtacacttacacagtatgaaaac
aaactgagactggtggaaattgctcaggtgccaaaagcgcatgttgacgaatttaagtct
gtttcaaaattcaagatcttcaatacaaacaacctgtgggtttcgttatcggcaattaaa
cggctgcaggaacaaaatgcaattgatatggaaattattgttaatccaaagactttagat
ggtggtttaaatgttattcagctggagactgctgttggtgctgctattaaaagttttgac
aattctttgggaataaatgtgcctcgtagccgtttcctgcctgtcaagaccacatctgat
cttctacttgtgatgtctaacctatatagccttcatgctggatctttaacaatgagtgag
aaaagggaatttcctactgtgccactggtcaaactgggaagctctttcaccaaggtccaa
gattacctgaggagatttgaaagtatcccagatatgcttgaactggatcatctgactgtt
tcaggcgatgtcacctttggcaaaaatgtagcattaaagggaactgtcatcattattgca
aaccatggggacaggatagatatcccaccgggagccgtactggagaacaaaatcgtttct
ggcaatctccggatcctggaccactga

DBGET integrated database retrieval system