KEGG   Anolis carolinensis (green anole): 100553424Help
Entry
100553424         CDS       T01608                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase-like
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Nucleotide sugar biosynthesis, eukaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    100553424
   00052 Galactose metabolism
    100553424
   00500 Starch and sucrose metabolism
    100553424
   00520 Amino sugar and nucleotide sugar metabolism
    100553424
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     100553424
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MSSFAKDFSKAMSQAGTSPFQEAIRQELEYSMKVELDKILATAPQNELPHTKKDLEGFKK
LFHRFLQEKGPSVDWGKIQRPPEDSIQPYEKIKARGLPDSIASVLNKLVVVKLNGGLGTS
MGCKGPKSLIGVRNENTFLDLTVQQIEHLNKTYNTDVPLVLMNSFNTDEDTKKILQKYSH
SRVKIYTFNQSRYPRINKESLLPIAKDVSYSGENTEAWYPPGHGDIYASFYNSGLLDNFI
DEGKEYIFVSNIDNLGATVDLYILNHLMNPPNGKRCEFVMEVTNKTRADVKGGTLTQYEN
KLRLVEIAQVPKAHVDEFKSVSKFKIFNTNNLWVSLSAIKRLQEQNAIDMEIIVNPKTLD
GGLNVIQLETAVGAAIKSFDNSLGINVPRSRFLPVKTTSDLLLVMSNLYSLHAGSLTMSE
KREFPTVPLVKLGSSFTKVQDYLRRFESIPDMLELDHLTVSGDVTFGKNVALKGTVIIIA
NHGDRIDIPPGAVLENKIVSGNLRILDH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcttttgcaaaagattttagcaaagcaatgtctcaggccggtacttccccattc
caggaagcaattagacaagaactggaatattccatgaaagtggaattggacaaaattctt
gcaactgcaccacagaatgaactgccgcacactaagaaggacctggaagggtttaaaaag
ctctttcatagattcttacaagaaaagggaccttctgtggactggggaaagatccagaga
cctccagaagactctatacagccctatgagaagataaaagccagaggtttgccagatagc
attgcttcagttttgaacaaactggttgtagtgaaactcaatggcggcttgggcaccagt
atgggatgcaagggccccaaaagccttattggggtgcggaatgagaataccttcctggat
ttgactgttcagcagatcgagcatctaaataaaacatacaatacagatgttccactagtt
ctaatgaactccttcaacactgacgaagacaccaaaaagatcttgcaaaaatacagccac
agtcgtgtgaaaatctacactttcaaccaaagcaggtacccacgcattaataaggaatct
ttactgccaatagcaaaagacgtgtcttactctggagagaatacagaggcttggtatcct
ccagggcatggtgacatctatgcaagtttctacaattctggattgctggataattttatt
gatgaggggaaggagtatatttttgtgtccaacatcgataaccttggtgccaccgttgat
ctctacattctcaaccacctcatgaatccgccaaatggaaaacggtgtgaatttgttatg
gaggtcaccaataaaacaagggcagatgttaagggcggtacacttacacagtatgaaaac
aaactgagactggtggaaattgctcaggtgccaaaagcgcatgttgacgaatttaagtct
gtttcaaaattcaagatcttcaatacaaacaacctgtgggtttcgttatcggcaattaaa
cggctgcaggaacaaaatgcaattgatatggaaattattgttaatccaaagactttagat
ggtggtttaaatgttattcagctggagactgctgttggtgctgctattaaaagttttgac
aattctttgggaataaatgtgcctcgtagccgtttcctgcctgtcaagaccacatctgat
cttctacttgtgatgtctaacctatatagccttcatgctggatctttaacaatgagtgag
aaaagggaatttcctactgtgccactggtcaaactgggaagctctttcaccaaggtccaa
gattacctgaggagatttgaaagtatcccagatatgcttgaactggatcatctgactgtt
tcaggcgatgtcacctttggcaaaaatgtagcattaaagggaactgtcatcattattgca
aaccatggggacaggatagatatcccaccgggagccgtactggagaacaaaatcgtttct
ggcaatctccggatcctggaccactga

DBGET integrated database retrieval system