KEGG   Anolis carolinensis (green anole): 100553460Help
Entry
100553460         CDS       T01608                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Sphingolipid metabolism
Metabolic pathways
Calcium signaling pathway
VEGF signaling pathway
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100553460
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100553460
   04020 Calcium signaling pathway
    100553460
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     100553460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 512 aa AA seqDB search
MNLLLGACGEGSETLLHGEFGAYPPKGTRYALSLTRTELHIQRLVPKPDTDHRTVVRLVD
VVGCHTMRSHTVANSSAFFCVYSYPLKKKKVAVGSGRARQRVAKTFQVDSSDRYEDNLHI
AEKWAAAIKCLVLGISVSSETEISRSLLPRPRRLLLLLNPFGGKGNALQWCQNHILPMIT
EADVSFNLIQTERQNHARELVQSISLAEWDGIVAISGDGLLYEVINGLMERPDWEEAIKM
PLGILPCGSGNAVAAAINFNAGFDQTLGQELLTNCTLLLCHGAVSPLDLVSITTSSGSRS
FSFLSVAWGFISDVDIESEKYRHMGSARFTLGTMVRLASLNTYRGRLSYLPAPDSTGHPP
TSLPSSTRQMRGPPDNFLAPLDQPVPKSWVTVEDDFVLVLAIYQTHLGADLFAAPFACFN
DGLIHLAYVKAGISRAALIRLFLAMEKGTHFEQGCPHVTNIPVRAFRIEPLTHKGIITVD
GERVEYGPIQGQIHHGVANLITGISPVKITKF
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacttctgggggcatgtggggaaggctccgagacactcctccacggggaattt
ggggcctatcctcccaaagggacgcgttatgccctgagcctcacacggacggagttgcac
atccagcgcctggtgcccaagccagacacagaccaccggactgtggtgcgactggtagat
gtggtgggatgccacaccatgcgcagccacaccgtggcaaacagctcggccttcttctgt
gtctactcttatcccctgaagaaaaagaaggtggcggtgggctctggccgggcccggcaa
cgcgtggcgaagacctttcaggtggacagctctgaccgctatgaggataacctccacatc
gcggagaaatgggcagctgcaatcaagtgcctggtgctggggatttctgtctcaagtgaa
acagagatcagcagaagcctcctgccccgtcctcgtcgcttgctccttctgctaaacccc
tttggcggcaaaggcaatgccctccagtggtgccagaatcacatcctgcccatgattaca
gaggccgatgtcagcttcaacttgatccaaacagagaggcagaaccatgcccgggagctg
gtacagagcatcagtttagctgaatgggatggcattgtagccatttcaggagatggactt
ctttatgaggtcattaatggtttgatggagcgtccagactgggaagaagccataaaaatg
ccccttgggattctcccctgtgggtctggaaatgcagtcgctgccgcaattaactttaat
gctgggtttgatcagaccttgggccaggaactgttgacgaattgcaccctcctgctttgc
cacggggcagtatcccccctggacctggtctccatcaccacctcctcaggctcccgctcc
ttctccttcctcagcgtggcctggggcttcatctccgacgtggacattgagagtgagaag
taccgccacatggggtcggcccgcttcaccttggggaccatggtccgtctggcctccctg
aacacctaccgggggcgcctctcgtaccttcccgccccagactccacaggccaccccccc
acctccttgccctcttccacccggcaaatgcgtggccccccagacaacttcttggctccc
cttgaccagccagtgcccaaatcttgggtgacggtagaggatgattttgtgctggtgttg
gccatctaccagactcacctgggggctgacctgtttgcggctccctttgcctgcttcaat
gacggcctcattcacctggcctacgtcaaggcaggcatttcccgggcagccctgatccgc
ctcttcttggccatggagaaaggcactcacttcgagcaaggctgcccccacgtcaccaac
atccccgttcgggccttccgcatcgaacccctcacccacaagggcatcatcactgtggat
ggtgagagggtggagtacggccccatccagggacaaatccaccatggggtggccaacctc
atcacagggatcagcccagtgaagattacgaagttctga

DBGET integrated database retrieval system