KEGG   Anolis carolinensis (green anole): 100553746Help
Entry
100553746         CDS       T01608                                 

Gene name
hadha
Definition
(RefSeq) hydroxyacyl-CoA dehydrogenase/3-ketoacyl-CoA thiolase/enoyl-CoA hydratase (trifunctional protein), alpha subunit
  KO
K07515  enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs00062  Fatty acid elongation
acs00071  Fatty acid degradation
acs00280  Valine, leucine and isoleucine degradation
acs00310  Lysine degradation
acs00380  Tryptophan metabolism
acs00410  beta-Alanine metabolism
acs00640  Propanoate metabolism
acs00650  Butanoate metabolism
acs01040  Biosynthesis of unsaturated fatty acids
acs01100  Metabolic pathways
acs01200  Carbon metabolism
acs01212  Fatty acid metabolism
Module
acs_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
acs_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
acs_M00085  Fatty acid biosynthesis, elongation, mitochondria
acs_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100553746 (hadha)
   00650 Butanoate metabolism
    100553746 (hadha)
  Lipid metabolism
   00062 Fatty acid elongation
    100553746 (hadha)
   00071 Fatty acid degradation
    100553746 (hadha)
   01040 Biosynthesis of unsaturated fatty acids
    100553746 (hadha)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100553746 (hadha)
   00310 Lysine degradation
    100553746 (hadha)
   00380 Tryptophan metabolism
    100553746 (hadha)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100553746 (hadha)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100553746 (hadha)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100553746 (hadha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-GeneID: 100553746
NCBI-ProteinID: XP_008122418
Ensembl: ENSACAG00000008531
Position
Un
AA seq 676 aa AA seqDB search
MAAAVRASGSWARFAAAAKYRPGRGGGRRPDGYACRNLSTSAPLKSRTHVNYDVKGDIAV
VRFNSPNSKVNTLSKQLQAEFTEVMNEIWANDAVSSAVLISGKPGCFIAGADINMIEACK
SSEEITQLSQEGQKMMDKLEKSPKPIVAAISGSCLGGGLEVAIACQYRIATKDKKTVLGT
PEVLLGLLPGAGGTQRLPKMVGIPAAFDMMLTGRNIRADKAKKMGLVDQLVDPLGPGIKS
PEERTMEYLEEVAVFFARGLANKTVSHKKDKGLVQRVTDYVMAIPFVRQQIYKTVEGRVQ
KQTKGLYPAPLNIIAVAKTGLEQGNEAGYLAESQRFGELGMTPESRALIGLYHGQVQCKK
NKFGQPKQPVKTLAILGAGLMGAGIAQVSVDKGLTTILKDTALEGLSRGQQQVYKGLNDK
VKKKSLTSFERDTILSNLTGQLDYKDFGRADMVIEAVFEDLSIKHKVLKEVEAVVPPHCI
FASNTSALPIHQIAAASQRPEKVIGMHYFSPVDKMQLLEIITTDKTSQDTAASAVAVGLK
QGKVIIVVKDGPGFYTTRCLAPMLAEIVRVLQEGTDPKKVDAISTGFGFPVGAATLIDEV
GVDVATHVAEDLGKAFGERFKGGNVELMKAMVDKGFLGRKAGKGFYIYQSGSKERSLNSG
MDEILEKFRVEAKPEV
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcggtcagggccagcgggagctgggcgcgcttcgccgccgccgccaagtac
aggcccggcaggggaggaggacggcgaccggacggctatgcctgccggaacctcagcacc
tccgcccctctcaaatctcggacgcatgtcaactatgacgtcaaaggcgacattgcagtt
gtgcggtttaactctccaaactccaaggtgaacacactctccaagcaactgcaagccgaa
ttcacagaagtcatgaacgaaatctgggccaacgatgccgtcagcagcgccgtcctcatc
tccggaaagccgggctgcttcatcgctggggccgacatcaacatgattgaggcctgcaaa
tcgagcgaagaaatcacccagctctctcaggaggggcagaagatgatggacaagctggag
aagtcccccaagcccattgtggctgccatcagtggctcctgcctgggagggggcctggag
gtggccattgcctgccagtacagaattgccaccaaagacaagaagacggtcctggggacg
ccggaggtgctgctggggcttttgccgggggccgggggcactcagcgcctgcccaagatg
gtggggatcccggcggcctttgacatgatgctgaccgggcgcaacattcgggccgacaaa
gccaagaagatggggctggtggaccagctggtggaccctctgggtccgggcatcaagagc
cccgaggagcggacgatggagtacctggaggaggtggccgtgtttttcgcccggggcctg
gccaacaagaccgtctcccacaagaaggacaagggcctggtccagagggtgacggactac
gtcatggccatccccttcgtgcgccaacaaatctacaaaacggtggagggacgggtccag
aagcagaccaaaggcctctacccggcacctctgaacatcattgcggttgcgaagacgggc
ctggagcaggggaacgaagccgggtaccttgcggagtcccagagatttggggaactcggg
atgaccccagagagccgggccctgatcgggctctaccacggacaggtccagtgcaagaag
aacaagttcgggcagccaaagcaacccgtcaagacgctggccatcctgggggccggcctg
atgggggcgggcattgcccaggtctctgtggacaagggactgaccactatcttgaaggac
acggccctggagggcttgagccgcgggcagcagcaggtctacaagggcttgaacgacaag
gtgaagaagaagagcctgacctcctttgagcgggacaccatcctcagcaacctgacgggg
cagctggactacaaggactttgggagggccgacatggtcatcgaggccgtctttgaggac
ctcagcatcaagcacaaagtcctgaaggaggtggaggcggtggtgcctcctcactgcatc
ttcgccagcaacacctccgccctccccatccatcagatagcggccgccagccaaagaccg
gagaaggtgatcgggatgcactacttctctcctgtggacaagatgcagctgctggagatc
atcacgaccgacaagacctcccaggacacagcggcttccgctgttgccgtgggcctcaag
caagggaaagtcatcattgtggttaaggatggtcccggtttctacaccaccaggtgcctc
gcccccatgttggctgaaattgtccgtgttctccaggaaggcacggatcccaagaaggtg
gatgccatctccaccggcttcggcttccctgtcggggcggccaccctgatcgacgaggtg
ggggtggacgtggccacgcacgtggcggaggacctgggcaaggccttcggggagcgcttc
aagggcgggaatgtggagctgatgaaggccatggtcgacaagggattcctgggccgcaaa
gcagggaagggcttctacatctaccagtccgggtccaaggagcgcagcctcaacagcggc
atggatgagatcctggagaagttccgggtggaggccaagccggaggtgtaa

DBGET integrated database retrieval system