KEGG   Anolis carolinensis (green anole): 100553790Help
Entry
100553790         CDS       T01608                                 

Definition
arginase-2, mitochondrial-like
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:acs01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:acs00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 357 aa AA seqDB search
MSLRSSFGRLLKQRAGSTLRVQKRPAHSVALIGAPFSRGQKKSGVDHGPAAIRDAGLVGK
LSRMGCQVYDLGDLNFTQIPNDELYNNLVKYPRSVGSASQVLADTVNGAVAAGHSCVTIG
GDHSLALGSISGHTRQYPHLCVIWVDAHADINTPLTTNSGNLHGQPVSFLLRELQDKVPQ
LPGFSWLKPCLSRSDIVYIGLRDVDPAEHYILKNYGIQYFSMRDIDRLGIQKVMERTFDH
LLSRGQRPIHLSFDIDAFDPTLAPSTGTPVLGGLTYREGMYISEEIHNTGLLSAVDLVEV
NPLLGTSQEDVAATANLAVEVIATCFGQTREGAHIVFDGLPTPSSPDESDSEEQVRI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcgcagcagcttcggccggctcctcaagcagcgggcgggatccacgttgagg
gtccagaagagaccggcgcactcggtggccctaattggagcccctttctcccggggccag
aaaaaaagcggagtagaccatggccctgccgccatcagggacgcggggctggtgggcaag
ctctcccgcatgggttgccaggtatatgatctgggagacttaaatttcactcaaatcccc
aatgatgagctctacaacaacctagtgaaatatccacgctctgtaggatcagctagccaa
gttctagctgacactgtgaatggagccgtggctgctggtcatagctgtgtaaccatcgga
ggtgatcacagtttagcacttggttccatcagtggccacacaaggcagtacccacacctc
tgtgtaatctgggtagatgcacatgcggacatcaatactccactcaccacaaattcaggg
aatctccatggacagccagtttcatttcttttaagggagcttcaagataaggtgccacag
cttcctggcttctcttggctaaaaccctgtctttcacgatcagatattgtatatattggc
ttaagagatgttgatcctgctgaacactatattctgaagaactatggcatccagtatttt
tcaatgagagatattgatcgcttagggatccagaaagtgatggagagaacctttgaccac
cttttaagcagaggacaaagacctatccatctcagcttcgacattgatgcctttgatcca
acattggctccatcaactgggactcctgtcttgggtggcttaacatatcgtgaaggaatg
tacatttcagaggaaatacacaacacaggcctgctttcagcagtggaccttgtagaagta
aatccgttgctcggaacgtcccaggaagacgtggctgcaacagctaaccttgcagtggaa
gtgattgccacatgctttggccaaacaagagaaggggcacacattgtttttgatggcctc
cccactcccagttcccctgatgaatctgacagtgaagagcaagtgcggatttag

DBGET integrated database retrieval system