KEGG   Anolis carolinensis (green anole): 100553790Help
Entry
100553790         CDS       T01608                                 

Gene name
arg2
Definition
arginase 2
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    100553790 (arg2)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    100553790 (arg2)
Enzymes [BR:acs01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     100553790 (arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 357 aa AA seqDB search
MSLRSSFGRLLKQRAGSTLRVQKRPAHSVALIGAPFSRGQKKSGVDHGPAAIRDAGLVGK
LSRMGCQVYDLGDLNFTQIPNDELYNNLVKYPRSVGSASQVLADTVNGAVAAGHSCVTIG
GDHSLALGSISGHTRQYPHLCVIWVDAHADINTPLTTNSGNLHGQPVSFLLRELQDKVPQ
LPGFSWLKPCLSRSDIVYIGLRDVDPAEHYILKNYGIQYFSMRDIDRLGIQKVMERTFDH
LLSRGQRPIHLSFDIDAFDPTLAPSTGTPVLGGLTYREGMYISEEIHNTGLLSAVDLVEV
NPLLGTSQEDVAATANLAVEVIATCFGQTREGAHIVFDGLPTPSSPDESDSEEQVRI
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcttcgcagcagcttcggccggctcctcaagcagcgggcgggatccacgttgagg
gtccagaagagaccggcgcactcggtggccctaattggagcccctttctcccggggccag
aaaaaaagcggagtagaccatggccctgccgccatcagggacgcggggctggtgggcaag
ctctcccgcatgggttgccaggtatatgatctgggagacttaaatttcactcaaatcccc
aatgatgagctctacaacaacctagtgaaatatccacgctctgtaggatcagctagccaa
gttctagctgacactgtgaatggagccgtggctgctggtcatagctgtgtaaccatcgga
ggtgatcacagtttagcacttggttccatcagtggccacacaaggcagtacccacacctc
tgtgtaatctgggtagatgcacatgcggacatcaatactccactcaccacaaattcaggg
aatctccatggacagccagtttcatttcttttaagggagcttcaagataaggtgccacag
cttcctggcttctcttggctaaaaccctgtctttcacgatcagatattgtatatattggc
ttaagagatgttgatcctgctgaacactatattctgaagaactatggcatccagtatttt
tcaatgagagatattgatcgcttagggatccagaaagtgatggagagaacctttgaccac
cttttaagcagaggacaaagacctatccatctcagcttcgacattgatgcctttgatcca
acattggctccatcaactgggactcctgtcttgggtggcttaacatatcgtgaaggaatg
tacatttcagaggaaatacacaacacaggcctgctttcagcagtggaccttgtagaagta
aatccgttgctcggaacgtcccaggaagacgtggctgcaacagctaaccttgcagtggaa
gtgattgccacatgctttggccaaacaagagaaggggcacacattgtttttgatggcctc
cccactcccagttcccctgatgaatctgacagtgaagagcaagtgcggatttag

DBGET integrated database retrieval system