KEGG   Anolis carolinensis (green anole): 100553854Help
Entry
100553854         CDS       T01608                                 

Definition
mitogen-activated protein kinase 7-like
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100553854
 Cellular Processes
  Cell communication
   04540 Gap junction
    100553854
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100553854
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100553854
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   100553854
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 908 aa AA seqDB search
MAEPPIEDEGEEAAQGQAKQESTHQATVAAKNLAILKARSFDVTFEVGDEYEVIETIGTG
AYGVVSSARRKDTGQQMAIKKIPNAFDVVMNAKRTLRELKILKHFKHDNIIAIKDILKPT
VPYAEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVIHRDLK
PSNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAID
MWSVGCIFAEMLGRKQLFPGKNYIHQLQLIITVLGTPPAKVVHSIGADRVRAYIQSLPSR
QPVPWETLYQNADRKALSLLSKMLRFDPRERISVVEALNHPFLAKYHDPDDEPNCVPAFD
FDFDKQVLTKEQIKEAIVAEINDFHERREGIRRQISFKPTLRPAAIGGGYGDETSSQTQL
LYCHDVDMPSAGSPRMADGDYAMASPVLCSLTETIDLTSPLTTTAVVQPEVKAEAEVPAA
PPKREGAISDDTKAALKAVILKSALRNKNKDTPSCVPETPDIRRPVTAKERQREREEKRK
RRQERAKEREKQKKEKERERRDMLTENDRNLLERWTKMVDRTQSKPAQNGSAALPQTTAP
SHNLPQAPSSNHLPPQVPPACHIPATPSSNTPAPADFLTFSDKGVPAVGPKLTIVPVGSV
QSSNTNVVHFFPAQTAPFLVATPACQKATPSKPECLLSVKYAPSQIFQAPYGVAALNAWS
GVPSPESWAASGQLPVTQPEIASSSSALPEQTSFGTTMEQPLFLAEMGKPEPPPSGFAEE
TSSVAKGPAQHQITSGLPLEPPDINVVTQQLSKSQVEDLLPPVFSGTPKGSGAGYGVGFD
LEEFLNQSFDMVGENRESQGDSAPLSASLLADWLEVHRMNPADMESLQQELQLGSPMILS
DIPDLQDA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcagagccgccgatagaagatgaaggggaggaggcagcccaaggccaagcaaagcag
gagtcaactcaccaggccacggtggcagccaagaatctcgccatcttgaaggctcgatcc
tttgacgtcacctttgaggtgggagatgaatatgaggtcattgagacgatcggcaccgga
gcttacggtgtggtcagctccgcacgtcgcaaggatacaggccagcagatggccatcaag
aaaatccccaatgcctttgatgtggtgatgaatgcgaagcgcactctgcgggagctgaag
atccttaagcatttcaagcatgacaacataatcgctatcaaggatatccttaaacccact
gtgccttatgctgaattcaaatctgtgtatgtggtgctggatttgatggagagtgacctg
catcagatcatccattcttctcagcctcttaccttggagcatgtccgctacttcctctac
cagcttttgcggggactcaaatacatccattcggccaacgtcattcatcgggacctcaaa
cccagcaatctgttgatcaatgagaactgtgaacttaagattggggactttggtatggcc
cgaggtctctgcaccaagccggacgagtacaagtacttcatgacagagtatgtggccacc
cgctggtacagggctcctgagctgatgctctccctccatgagtatacccaggccatagat
atgtggtcagttgggtgcatttttgccgagatgcttgggcggaagcagctctttccaggg
aagaattacatccaccagcttcagctcatcatcaccgtcctgggcactcctccggccaaa
gtggtccattccattggagctgaccgggtgcgggcctacatccagagcctgccttcgcgc
cagccggtgccatgggagaccctctatcagaatgccgaccggaaggccttgtctttgctt
tcaaagatgctccgctttgatccccgtgagcgaatatcagtggtggaggccctgaatcac
cccttcctggccaagtatcacgacccagatgatgagcccaactgcgtcccggcttttgat
ttcgattttgacaaacaggtactcaccaaggagcagatcaaagaagccatagtggccgaa
atcaatgacttccatgagcgccgggagggcattcggcgccagatcagcttcaagccaacc
ttgaggccggctgctattggcgggggttatggggatgaaacctccagccaaactcagctt
ctgtactgtcatgacgtggatatgcccagtgctggttcacctagaatggcagatggtgac
tatgcaatggcgtctcctgtcctatgctccctgacggagacaatagatctcacctcaccc
ctcacaaccacagctgtggtacagcccgaggtgaaggctgaagcagaagtccccgcagct
cctcccaagagggaaggggccatctcagatgacactaaggctgccctcaaggctgttatc
ttaaaatccgccctccgaaataagaataaagatacgccatcctgtgtcccagagactcct
gatatccgaaggccagtgacggcaaaggagcgccaacgggagcgagaagagaaacgcaag
cggcgccaggaacgagccaaggagcgggagaagcagaagaaggagaaagagagagagcgc
agggacatgctgacagagaatgaccgcaaccttctggaaaggtggaccaaaatggtggac
cgaacccaaagcaagccagcccagaatgggtctgcagcccttccgcagacaaccgcaccc
agccacaacctgcctcaagccccttctagcaaccacttgccacctcaggtgccccctgct
tgccatatcccggctaccccttccagcaacacacctgcaccggctgactttcttactttc
tcagacaagggagtgcctgccgtgggacccaagctgacaattgtccctgtgggttcagtt
cagagctccaatacaaacgtggtgcattttttcccagcgcagactgccccgttcctggtg
gccaccccagcttgccaaaaagccaccccctcaaagccagagtgcctcctgagtgtcaaa
tatgcccccagccagatcttccaagccccttatggtgttgcggcactgaacgcttggagc
ggtgtcccctcgcctgagagctgggctgcgtcaggtcagctgccagtgacccaaccagag
atagcatcttccagtagcgccctgcccgaacaaacaagttttgggaccactatggagcag
cctctgttcctggcagaaatgggcaagcctgagcctccaccatcaggttttgctgaagaa
acatcatcagtggcaaaggggcctgctcagcaccagataacctcaggcctgcctttggaa
cctccagatattaatgtggtaacacagcagctgtctaaatcccaggtggaagatctcctg
cctcctgttttctctggcaccccaaaaggcagtggtgctggctatggggttgggtttgac
ttggaagaattcctgaatcagtctttcgatatggtaggagagaacagagaaagccaagga
gattctgcccctctttcggcctcccttcttgccgactggttggaagtccatcggatgaac
ccagccgatatggagtccctccaacaagaactccagctgggctctcccatgatcctgtcc
gacattcccgacctccaggatgcatga

DBGET integrated database retrieval system