KEGG   Anolis carolinensis (green anole): 100553854Help
Entry
100553854         CDS       T01608                                 

Gene name
mapk7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Gap junction
GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100553854 (mapk7)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    100553854 (mapk7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100553854 (mapk7)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100553854 (mapk7)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100553854 (mapk7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 908 aa AA seqDB search
MAEPPIEDEGEEAAQGQAKQESTHQATVAAKNLAILKARSFDVTFEVGDEYEVIETIGTG
AYGVVSSARRKDTGQQMAIKKIPNAFDVVMNAKRTLRELKILKHFKHDNIIAIKDILKPT
VPYAEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVIHRDLK
PSNLLINENCELKIGDFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAID
MWSVGCIFAEMLGRKQLFPGKNYIHQLQLIITVLGTPPAKVVHSIGADRVRAYIQSLPSR
QPVPWETLYQNADRKALSLLSKMLRFDPRERISVVEALNHPFLAKYHDPDDEPNCVPAFD
FDFDKQVLTKEQIKEAIVAEINDFHERREGIRRQISFKPTLRPAAIGGGYGDETSSQTQL
LYCHDVDMPSAGSPRMADGDYAMASPVLCSLTETIDLTSPLTTTAVVQPEVKAEAEVPAA
PPKREGAISDDTKAALKAVILKSALRNKNKDTPSCVPETPDIRRPVTAKERQREREEKRK
RRQERAKEREKQKKEKERERRDMLTENDRNLLERWTKMVDRTQSKPAQNGSAALPQTTAP
SHNLPQAPSSNHLPPQVPPACHIPATPSSNTPAPADFLTFSDKGVPAVGPKLTIVPVGSV
QSSNTNVVHFFPAQTAPFLVATPACQKATPSKPECLLSVKYAPSQIFQAPYGVAALNAWS
GVPSPESWAASGQLPVTQPEIASSSSALPEQTSFGTTMEQPLFLAEMGKPEPPPSGFAEE
TSSVAKGPAQHQITSGLPLEPPDINVVTQQLSKSQVEDLLPPVFSGTPKGSGAGYGVGFD
LEEFLNQSFDMVGENRESQGDSAPLSASLLADWLEVHRMNPADMESLQQELQLGSPMILS
DIPDLQDA
NT seq 2727 nt NT seq  +upstreamnt  +downstreamnt
atggcagagccgccgatagaagatgaaggggaggaggcagcccaaggccaagcaaagcag
gagtcaactcaccaggccacggtggcagccaagaatctcgccatcttgaaggctcgatcc
tttgacgtcacctttgaggtgggagatgaatatgaggtcattgagacgatcggcaccgga
gcttacggtgtggtcagctccgcacgtcgcaaggatacaggccagcagatggccatcaag
aaaatccccaatgcctttgatgtggtgatgaatgcgaagcgcactctgcgggagctgaag
atccttaagcatttcaagcatgacaacataatcgctatcaaggatatccttaaacccact
gtgccttatgctgaattcaaatctgtgtatgtggtgctggatttgatggagagtgacctg
catcagatcatccattcttctcagcctcttaccttggagcatgtccgctacttcctctac
cagcttttgcggggactcaaatacatccattcggccaacgtcattcatcgggacctcaaa
cccagcaatctgttgatcaatgagaactgtgaacttaagattggggactttggtatggcc
cgaggtctctgcaccaagccggacgagtacaagtacttcatgacagagtatgtggccacc
cgctggtacagggctcctgagctgatgctctccctccatgagtatacccaggccatagat
atgtggtcagttgggtgcatttttgccgagatgcttgggcggaagcagctctttccaggg
aagaattacatccaccagcttcagctcatcatcaccgtcctgggcactcctccggccaaa
gtggtccattccattggagctgaccgggtgcgggcctacatccagagcctgccttcgcgc
cagccggtgccatgggagaccctctatcagaatgccgaccggaaggccttgtctttgctt
tcaaagatgctccgctttgatccccgtgagcgaatatcagtggtggaggccctgaatcac
cccttcctggccaagtatcacgacccagatgatgagcccaactgcgtcccggcttttgat
ttcgattttgacaaacaggtactcaccaaggagcagatcaaagaagccatagtggccgaa
atcaatgacttccatgagcgccgggagggcattcggcgccagatcagcttcaagccaacc
ttgaggccggctgctattggcgggggttatggggatgaaacctccagccaaactcagctt
ctgtactgtcatgacgtggatatgcccagtgctggttcacctagaatggcagatggtgac
tatgcaatggcgtctcctgtcctatgctccctgacggagacaatagatctcacctcaccc
ctcacaaccacagctgtggtacagcccgaggtgaaggctgaagcagaagtccccgcagct
cctcccaagagggaaggggccatctcagatgacactaaggctgccctcaaggctgttatc
ttaaaatccgccctccgaaataagaataaagatacgccatcctgtgtcccagagactcct
gatatccgaaggccagtgacggcaaaggagcgccaacgggagcgagaagagaaacgcaag
cggcgccaggaacgagccaaggagcgggagaagcagaagaaggagaaagagagagagcgc
agggacatgctgacagagaatgaccgcaaccttctggaaaggtggaccaaaatggtggac
cgaacccaaagcaagccagcccagaatgggtctgcagcccttccgcagacaaccgcaccc
agccacaacctgcctcaagccccttctagcaaccacttgccacctcaggtgccccctgct
tgccatatcccggctaccccttccagcaacacacctgcaccggctgactttcttactttc
tcagacaagggagtgcctgccgtgggacccaagctgacaattgtccctgtgggttcagtt
cagagctccaatacaaacgtggtgcattttttcccagcgcagactgccccgttcctggtg
gccaccccagcttgccaaaaagccaccccctcaaagccagagtgcctcctgagtgtcaaa
tatgcccccagccagatcttccaagccccttatggtgttgcggcactgaacgcttggagc
ggtgtcccctcgcctgagagctgggctgcgtcaggtcagctgccagtgacccaaccagag
atagcatcttccagtagcgccctgcccgaacaaacaagttttgggaccactatggagcag
cctctgttcctggcagaaatgggcaagcctgagcctccaccatcaggttttgctgaagaa
acatcatcagtggcaaaggggcctgctcagcaccagataacctcaggcctgcctttggaa
cctccagatattaatgtggtaacacagcagctgtctaaatcccaggtggaagatctcctg
cctcctgttttctctggcaccccaaaaggcagtggtgctggctatggggttgggtttgac
ttggaagaattcctgaatcagtctttcgatatggtaggagagaacagagaaagccaagga
gattctgcccctctttcggcctcccttcttgccgactggttggaagtccatcggatgaac
ccagccgatatggagtccctccaacaagaactccagctgggctctcccatgatcctgtcc
gacattcccgacctccaggatgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system