KEGG   Anolis carolinensis (green anole): 100553896Help
Entry
100553896         CDS       T01608                                 

Gene name
arhgap5
Definition
Rho GTPase activating protein 5
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:acs00001]
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    100553896 (arhgap5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1505 aa AA seqDB search
MMAKNKEPRPPSYAISVVGLSGTEKDKGNCGVGKSCLCNRFVRSKADEYYPEHTSVLSTI
DFGGRVVNNDHFLYWGDVIQCGEDGVDCKIHVIEQTEFIDDQTFLPHRSTNLQPYIKRAA
ATKLQSAEKLMYICTDQLGLEQDFEQKQMPEGKLNIDGFLLCIDVSQGCNRKFDDQLKFV
NNLYIQLSKSKKPIIIAATKCDECVEHYLREVQAFASNKKNLLVVETSARFNVNVETCFT
ALVQMMDKTRGKPKIIPYLDAYKTQRQLVVTSTDKFEKLVQTVRDYHATWKTVSNKLKNH
PDYEEYINLEGTKKAKNTFSKHIEQLKQEHIRKRRDEYINTLPRAFNTLLSNLEEIEHLS
WSEALKLMEKRQDFQLCFVVLEKTPWDETDHIDKVNDRRIPFDLLNTVEAEKVYQNHVQH
LISEKRRVEMKEKFKKTLEKIQFISPGQPWEEVMCFVMEDEAFKYITEADSREVYSRHQR
EIVEKAKEEFQEMLFEHSELFYDLDLNATPSTDKMSEIHAVLSEEPRYKALQKLAPDRES
LLLKHIGFVYHPTKETCLSGQNCMDIKVEQLLAGSLLQLDHGRVHFYHDSANIDKVNIFI
LGKDGLAQELANEIRTQSTDDEYALDGKIYELDLRPVDAKSPYLLSQLWASAFKPHGCFC
VFNSIESLNFIGESIGKIRAEASQIKRDKYMANLPFTLILANQRESVSKNLPILRHQGQQ
LANKLQCPFIDVPAGTYPRKFNETQVKQALRGVLEAVKHNFDVVSPVPTIKDLSEADLRI
VMCGMCGDPFSVDLILSPFLDSHSCSAAQAGQNNSLMLDKIIGEKRRRIQITILSYHSSI
GVRKDELVHGYILVYSAKRKASMGMLRAFLSEVQDTIPVQLVAVTDSQADFFENEAIKEL
MTEGEHIATEITAKFTALYSLSQYHRQTEVFTLFFSDVLDKKNMIENSYMSDNAREATHT
SEDVFLHSPRGSSLAYNYYPDSEDDTEAPPPYSPIGDDVQLLPTPDRSKYRLDLEGNEYP
THSTPLNCHDHERNHKVPPPIKPKPIVPKTNVKKLDPNLVKTIEAGIGKNPRKQSRMALA
PTDDLDQSDNYAEPIDTVFKHRGLTDDIYVIPDDSQNRVVKIRNSFIISNVPGDEENGFP
DRISKTQGERRPSKYKYRSKTLFSKAKSYYRRAHSDASDDEAFTTSKTKRKGRHRGSEED
PLLSPAETWKAGIDNPAITSDQELDDKKTKKKTQKVKEDKKQKKKTKTFNPPTRRNWDSN
YFGMPLQDLVTPEKPIPFFVEKCVEFIEDTGLCTEGLYRVSGNKTDQDNIQKQFDQDHNI
SLESMDVTVNAVAGALKAFFADLPEPLIPYSLHPELVEASKILDKTERLYELKEIVKKFH
PVNYEVFRYIITHLNRVSQQSRTNYMTADNLSICFWPTLMRPDFENREFLSTTKILQSVI
ETFIQQCQFFFYGGEIFEPFDSVAHQPPPPNPVQMVDQILPLQLPPPLQPQLIQPQLQTD
PLGII
NT seq 4518 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaagaacaaagagcctcgtcccccatcctatgctattagtgtggttggactt
tctggaactgaaaaagacaaggggaactgtggagttgggaagtcgtgtttgtgcaatagg
tttgtgcgctcaaaagcagatgaatattaccctgaacatacctctgtgcttagcacaatt
gactttggtggacgagttgttaataatgatcactttttgtactggggtgacgtaatacaa
tgtggagaggatggagtagattgcaaaattcatgttattgaacagactgagttcattgat
gatcagacttttctgcctcatcggagtacgaacttacaaccttacataaaacgtgcagct
gcaaccaaattgcagtcagcagaaaaacttatgtatatttgcacagatcagcttggatta
gagcaggactttgagcaaaagcaaatgcctgaaggaaagctaaatattgatggattttta
ttatgcattgatgtaagtcaaggatgcaataggaagtttgatgaccaacttaaatttgta
aataacctctatattcagctatcaaaatctaaaaagcctataataatagcagcaactaaa
tgtgatgaatgtgtggaacattatttacgagaagttcaagcatttgcttcaaataaaaag
aaccttctggtagttgaaacatcagcaagattcaatgtcaatgtagaaacatgttttact
gcactggtacaaatgatggataaaacccgtggtaaacctaaaataattccctatctggat
gcctataaaacacagagacagcttgttgtgacttcaacagataaatttgagaaacttgta
cagactgtgagagactatcatgccacttggaaaacagttagtaacaaactgaaaaatcat
ccagattatgaagaatacattaatttggagggaaccaaaaaggccaaaaatacattttca
aaacatatagagcaacttaaacaagaacatataagaaaaagaagagatgaatatattaat
acattaccaagagcttttaacacacttctgtccaaccttgaagagattgagcatctgagt
tggtctgaagctttgaaacttatggagaaaaggcaagattttcaactatgttttgtagtg
ctcgaaaaaaccccgtgggatgaaactgaccatatagataaagtgaatgacagaagaatt
ccatttgaccttttgaacacagtagaagctgaaaaagtgtatcaaaatcatgtgcagcat
ctaatatcagaaaaaaggagagttgaaatgaaggagaagttcaaaaaaacacttgaaaaa
atacaattcatttctcctggtcaaccctgggaagaagttatgtgttttgtaatggaggat
gaagcttttaaatatattacagaggcagatagtagagaagtctatagtaggcatcaacgg
gaaatagttgaaaaagccaaagaggagtttcaggaaatgctttttgaacattcagaactg
ttttatgacctggatttgaatgcaacaccaagtactgataaaatgagtgaaattcatgca
gttttgagtgaagagcctagatacaaagctttacagaaacttgcacctgatagagagtct
cttcttcttaaacacatcggatttgtatatcatcctactaaagaaacatgtctcagtggc
caaaactgtatggacattaaagtagaacagttacttgctggtagtcttttgcaattggac
catggccgtgtacatttttatcatgatagtgccaacattgataaagtaaatattttcatt
ttgggtaaagatggacttgcacaagagctggcaaatgagattcggacgcagtctacagat
gatgaatatgccttagatggaaaaatatatgaacttgatcttagaccggttgatgcaaag
tcaccttatcttttaagtcagttatgggcttctgccttcaaaccacatgggtgtttctgc
gtgtttaattcaattgaatcacttaattttattggagaatcgattggaaaaatcagagct
gaggcatctcagataaaaagagacaagtatatggccaatcttccatttactttaatcctg
gctaatcagagagagagtgttagcaagaatttgccaatcctgagacatcaaggacaacag
ttggcaaataagttgcagtgtccttttatagatgtccctgctggtacttacccacgtaaa
tttaatgagactcaagtaaaacaagctttgcggggagttctggaagctgttaaacataac
tttgatgttgtaagtcctgttcctacaattaaagacctctcagaagctgatttaaggatt
gttatgtgcggcatgtgtggcgatcccttcagtgtagatcttattctttcacccttcctt
gattcccattcctgtagtgctgcccaagctggccagaataattcgttaatgcttgataaa
attataggtgagaaacggagacgaattcaaataacaatattatcatatcattcttcaatt
ggtgtaagaaaagatgaactcgttcatggatatatattagtttactctgccaaaagaaaa
gcatctatgggaatgcttcgagcatttctgtcagaagtgcaagatacaattcctgtccag
ttggtagctgttactgacagtcaagcagacttttttgagaatgaagctatcaaggaatta
atgactgaaggtgaacatatagcaactgagatcactgctaaatttacagccctatattct
ttatctcagtatcaccgtcaaactgaggtttttacattgttcttcagtgatgttttagac
aagaagaatatgattgaaaattcctatatgtctgataatgcaagagaggcaacacacaca
agtgaggatgtgttcttgcattctcccagagggagctctcttgcttacaattattatcca
gattcagaagatgatactgaggccccacctccttacagcccaattggagatgatgtacag
ctactcccaacacctgatcgctcaaaataccgattagatttggaaggtaatgaatatcct
actcatagtacacctttgaactgtcatgatcatgaacgcaaccataaagtgcctcctccc
ataaaaccgaagccaatagtgcccaagacaaatgtgaaaaaactagatccaaacctagta
aaaaccattgaggcaggcattgggaaaaacccaaggaaacaatctagaatggctttggca
ccaactgatgatcttgatcagtctgataattatgcagaaccaatagacactgtttttaag
cacagaggtcttactgatgatatctacgtaattccagatgatagtcagaatcgtgtggtt
aagattcgaaattcatttattataagtaatgtcccaggagatgaagaaaatggctttcct
gatagaatttcaaagacccaaggtgaaagaagaccttcaaaatacaaatacagatctaaa
acgctgttcagtaaagccaaatcgtattataggagagcacattcagatgcaagcgatgat
gaagcttttactacatctaaaacaaaaaggaaaggaagacatcgtggtagtgaagaagat
cctcttctgtcccctgcagaaacatggaaagctggcattgataatcctgctattacatca
gatcaagaattagatgataaaaagacaaagaagaagacccagaaggtgaaagaagataag
aaacaaaaaaagaaaacgaagacattcaatccaccaactcgtagaaattgggatagcaat
tactttgggatgcccctgcaggatttggttacacctgaaaagcctatcccattctttgtt
gagaagtgtgtggaattcattgaagacacaggtctttgtactgaaggtctctatcgtgta
agtgggaataaaacagatcaggacaacattcaaaagcagtttgatcaagatcataatatc
agtctggaatctatggatgtcactgtaaatgctgtggcaggagctctgaaagctttcttt
gcagatctgccagaacctttaattccttattccctccatccagaactagttgaagcatca
aaaattcttgataagaccgagaggctgtacgaattaaaagaaattgtgaaaaaattccat
cccgtgaactatgaagtcttcagatacatcataactcatctgaacagggttagtcagcaa
agcagaaccaattatatgactgcagacaacttatctatctgtttttggccaacactgatg
agacctgattttgaaaacagagagttcttatcaactaccaagattcttcaatccgtaata
gagacattcattcaacagtgccagtttttcttctatggtggagaaatttttgaacccttt
gacagtgtggcacatcagcctccacctcccaacccagttcagatggtggatcaaatttta
ccactacagttacccccacctctacaacctcaactgatacaaccacaattgcaaacagat
cctcttggcattatttaa

DBGET integrated database retrieval system