KEGG   Anolis carolinensis (green anole): 100553986Help
Entry
100553986         CDS       T01608                                 

Gene name
mos
Definition
v-mos Moloney murine sarcoma viral oncogene homolog
Orthology
K04367  
proto-oncogene serine/threonine-protein kinase mos [EC:2.7.11.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Oocyte meiosis
Regulation of actin cytoskeleton
Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100553986 (mos)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100553986 (mos)
  Cell growth and death
   04114 Oocyte meiosis
    100553986 (mos)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    100553986 (mos)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100553986 (mos)
Protein kinases [BR:acs01001]
 Serine/threonine protein kinases: Other group
  MOS family
   100553986 (mos)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 296 aa AA seqDB search
MPSPLPHNRLLHLQFSSSVNARPCSSPLLFPDKAEKFFCAEGVSPRVRRLPTRLAWCSID
WDQLCLLHPLGSGGFGSVYKAIYHGTTVAVKQVKKSSKNSLASRQSFWAELNVAHLDHNN
VVRLVAASTCAPASQDTLGTIIMEYVGNSTLHHVIYGTDCKTEKSKDDGLGSGHVSLSIS
EALGYSCDIVAGLIFLHSQTIVHLDLKPANVFITEQNICKLGDFGCSQKLQDLESSSPLL
SQQGGTYTHRAPELLKGSLFQDICCAEEFSSRGFCISPNSKPQDSTRWMESCQLNC
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgccatctcctcttcctcataatcgtcttcttcatctacaattttcttcatctgtgaat
gcacggccctgcagtagtcccttgttgtttccagacaaagctgaaaagtttttttgcgcc
gaaggtgtttcgcccagggttcgccgactaccgactcgcctagcttggtgttcaatagac
tgggatcagttgtgtttactacaccccctgggatcaggtggctttggttcagtctacaag
gctatttatcatggaactacagtggcagtaaagcaggtgaagaaaagcagtaagaacagt
ttggcatcacggcagagtttctgggcagaattaaatgtggcacatcttgaccataataat
gtggtacgtttagtagctgctagcacatgtgcccctgccagtcaggacactttgggcacc
ataataatggaatatgtaggtaacagtactctgcaccatgttatctatgggactgactgc
aagacagaaaaaagtaaggacgatgggcttggaagtggccatgtatctttgagcataagt
gaggcattaggctattcttgtgacattgtagcaggtctcatcttccttcattcgcaaacg
attgtgcatttggatttaaaacctgctaatgtattcatcactgaacaaaatatttgcaaa
cttggagactttggatgctcccaaaaactacaggatcttgaatcatcaagtccactactt
tctcaacaaggtgggacatacacccaccgtgctcctgaactccttaaaggctccctcttc
caggatatctgttgtgcagaagagttctctagcagaggattctgtatttctccaaacagc
aagcctcaggattctacaagatggatggagtcatgtcaattaaattgttaa

DBGET integrated database retrieval system