KEGG   Anolis carolinensis (green anole): 100554054Help
Entry
100554054         CDS       T01608                                 

Definition
protein-L-isoaspartate(D-aspartate) O-methyltransferase-like
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     100554054
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 247 aa AA seqDB search
MSCTLALATLLMGLLLSRTMAWTSTGKTHAELLNNLYKNGVIKSQRVFDVLVATDRAHYI
KYFPYMDSPQSIGYKATISAPHMHAHALELLKEQLVEGAKALDVGSGSGYLTACFARMVG
PTGKAVGIEHIEELVHESIKNVREDDPTLLSSGRVKLIVGDGRKGYPEEAPYDAIHVGAA
APTVPKALLNELKPGGRLILPVGPEGGNQIMMQYDKTKDGQIVEKQLMGVIYVPLTDKEK
QWPRGEL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagctgtacattggcacttgctaccttgctcatgggacttctgttatccagaaccatg
gcttggacctcaaccgggaagacacacgctgagctactcaacaacctttacaaaaatggt
gtgattaagtctcagcgcgtttttgatgtcttagtggccaccgacagagctcattatatc
aagtatttcccctatatggattctcctcagtcaattgggtacaaggctacaataagtgca
cctcacatgcatgcccatgcccttgagttactgaaggagcagttagtggaaggagcaaaa
gccctggatgtagggtcaggaagtggataccttacagcctgctttgctaggatggtgggc
ccaacagggaaagcagtgggcattgaacacattgaagagctggttcatgaatccatcaaa
aatgtcagggaagatgatccaactttgctgagttctggacgagttaaacttatagttggg
gatggcaggaaggggtacccggaagaagccccttatgatgccatccatgttggagcagct
gcccccacggtgccaaaggcgttactgaatgagttgaaacccggaggccgactcatcctg
ccagttgggcccgagggtggaaaccagattatgatgcagtatgacaagactaaagacggt
cagattgtggaaaagcaactgatgggagtgatatatgttcctctgacagacaaggagaaa
caatggcctcggggtgaactttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system