KEGG   Anolis carolinensis (green anole): 100554192Help
Entry
100554192         CDS       T01608                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-A-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100554192
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100554192
Glycosyltransferases [BR:acs01003]
 Glycan extension
  Type 3 chain
   100554192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 363 aa AA seqDB search
MGVLNSKTSFLAFHLGLIAGFLSTFYLVGNLIWEGAPRPDTQPPHASKDPQWIVERSALF
SVSHPHLADEESSVADMLYNKVRILCWVMTGPKNLETKAHHVKATWSRHCNVVLFMSSEK
DDNFPTVGLDTKEGRDQLYWKTIRAFHYVHQHHLEQADWFLKADDDTFVVVDNLRWLLSN
YTPDRPIYFGKRFRPFAKQGYMSGGAGYVLSKEALQRFVAGFESKVCSHTTSVEDLALGQ
CMEKMGVEAGDSRDSEGRETFHPFVPESHLTDKFSKSFWYWNYCYYPIVEGPQCCSDLAV
SFHYVNPELMYTLEYLTYHLRAYGYRYRYNPPLSENAAHLKSHPARKPPERANSTILQVE
KKL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgggggtccttaactccaaaacctccttcttggctttccacctgggcctcattgctggc
ttcctcagcaccttctacctcgtgggcaacctaatctgggaaggggccccacgccctgac
acccagccacctcatgcttccaaggatccccagtggattgtggaaagatctgctctcttc
agtgtatcacacccacatctggcagatgaggagagcagtgtggcagacatgctgtacaac
aaggtccggatcttgtgttgggtgatgacaggccccaaaaacctggagaccaaggcccac
catgtcaaggccacctggtcccgtcactgcaacgtggtgcttttcatgagctcagaaaaa
gatgacaacttccccactgttggtttggataccaaggaaggccgtgaccagctctactgg
aagaccatcagggctttccattatgtgcaccagcaccacctggaacaggcagactggttc
ctcaaggcagatgacgacacctttgtggtggtggacaacctccggtggctgctttccaac
tacacccctgatagacccatctattttggcaagcgcttccggccttttgctaaacaaggc
tacatgagtggaggggctggctatgttctcagcaaagaggctctgcagcgctttgtggct
ggatttgaatccaaagtgtgcagccacactacctcagtggaggaccttgctctgggacag
tgcatggagaagatgggtgtggaggctggagactcccgggactctgaggggcgggagacc
ttccatccttttgtgccagaatcccatctgacagataagttctccaaaagcttttggtac
tggaactattgctactaccctattgtggagggtcctcagtgttgctctgatctggctgtc
tccttccactatgtaaacccagaattgatgtacacactggaatatttgacctaccacctg
cgtgcctatggttaccgctaccgctacaacccacctctgtcggagaatgcagctcacctc
aagtcccacccagcaagaaagcccccagagagggccaacagcaccatcctgcaggtggaa
aagaagttgtag

DBGET integrated database retrieval system