KEGG   Anolis carolinensis (green anole): 100554251Help
Entry
100554251         CDS       T01608                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 408 aa AA seqDB search
MAGLSAMEKKLTEYKCDTNEAIHLKLVRFPEDMEDDSTTFHPEFSHQVFGDDEVAFGYKG
LKILLYYVAGNLSTLFRVDYTSRVNENFDCMEADDVETKVREIIPPGFSRSTDDFISLLE
KEVNFKPFGILLHSYSVHNEEAGDDITYQIYKADMTCSGFREYHERLQTFLMWFIETANF
IDVDDERWNYFLVFEKYNKDGATLFATVGYMTVYNYYVYPDKTRPRVSQMLILPPFQGEG
HGAQLLETVHRYYMSSPTVLDITAEDPSENYVKLRDFVLVKLCQDLPCFSPEKLEQGFSQ
DMVTEAQQKLKVNKQHTRRVYEILRLHATDMSNPDQSRNYRLDVKRRLMGPYKKKQREIA
KMRRCLRPEELTNQLNQIDINLQHKQLEENFQQLVSDYRRVLERLAQV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcggggctttctgctatggagaagaaattgactgagtacaagtgtgatacaaatgaa
gcgattcatctaaaattagtccgctttccagaggatatggaagatgacagcacaacattc
catccagagttcagccatcaagtttttggggatgatgaggtagcctttggttacaaagga
ttgaagattcttttgtactacgttgctggtaacctgtcgacactgttccgtgtggattat
acatccagagttaatgagaactttgactgcatggaggcagatgatgtggaaactaaagtt
agagaaataattccaccaggttttagcagaagtacagatgactttatatctttactggaa
aaagaggttaacttcaagccatttgggatattactacactcatattctgtgcataatgaa
gaagcaggcgacgacattacatatcaaatatataaggctgatatgacatgctcagggttt
cgagagtatcatgaaaggcttcagaccttcttgatgtggtttattgaaacagcgaacttt
attgatgtggatgatgaaagatggaactactttctagtatttgagaagtataataaggac
ggagctacgctctttgcgaccgtgggctatatgacagtctataattactatgtgtaccca
gacaaaacccggccacgtgtaagccaaatgctgatattgcctccattccaaggtgaaggc
catggggctcagcttttagaaacagttcacagatactatatgtcgtctcctacagtactt
gatataacagctgaagatccatctgaaaactatgtgaaactacgagattttgtattagtg
aaactgtgtcaagatttaccttgcttttcgccagaaaagcttgagcaaggtttcagtcaa
gatatggtaacagaagctcaacagaagttgaaagtaaacaagcaacatactagacgggtt
tatgaaattctccggctgcatgcaacagacatgagcaatcccgatcaatctagaaattac
agattggatgtaaaaagaagactaatgggaccttataagaaaaagcagcgagagattgct
aaaatgagaagatgcctgagacctgaagagctgaccaatcagttaaaccaaatagacata
aacttacaacacaagcaactagaggagaacttccagcagcttgtttcagattaccgaaga
gtcctagaacggctggctcaagtctga

DBGET integrated database retrieval system