KEGG   Anolis carolinensis (green anole): 100554316Help
Entry
100554316         CDS       T01608                                 

Definition
alpha-1A adrenergic receptor-like
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
acs  Anolis carolinensis (green anole)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100554316
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100554316
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100554316
   04270 Vascular smooth muscle contraction
    100554316
G protein-coupled receptors [BR:acs04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [Table]
    100554316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 464 aa AA seqDB search
MSLNVENISVPACVNCTQTVEEVNVLKAILLGVIFGGLIIFGVLGNILVILSVACHKHLQ
SVTHYYIINLAVADLLLTSTVLPFSAIFEIFGYWIFGRIFCNIWAAVDVLCCTASIMSLC
VISIDRYIGVSYPLRYPSIVTEKRGLLALLCIWVLSLVISIGPLFGWKQPAPEDEKICQI
NTDPGYVLFSAFGSFYLPLIIILVMYCRVYVVARRESKGLSCGLKTEKSHSEEVTLRIHC
KNATETTGSTPSTKHKSHFSMRLLKFSREKKAAKSLGIVVGCFILCWLPFFLIMPIGSFF
PESKPSDTVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRGQCLPRRYSANKYSLS
FNHHHPSNHVAETPKDVVCIPVNSGENFYKISKSDGICEWKLFSTVQSMSTKSASSKDKA
KVKSKGFLRVCCCADTSGSDHPKGQKVPTIKIHTISISDNGEDV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgagcttgaatgttgaaaacatctctgtccctgcctgtgtcaactgtacccagacggtg
gaggaagtcaatgttttaaaggccatcctgctaggcgtgatctttgggggtctgatcatt
tttggggtcctgggcaacatcttggtgatcctttcggtcgcctgccacaaacacctccaa
agcgtaacccactactacatcatcaacttggcagtggccgaccttctcttaacttctacc
gtcctccccttttctgctatttttgagatatttggctactggatttttgggaggatcttc
tgtaacatctgggcagctgttgatgttctttgctgcactgcttccatcatgagcctttgt
gtcatctccatagaccgatacattggagtgagctatccgctaaggtatccttccatcgtg
accgagaagagaggtctcctagccttgctgtgcatctgggtgctgtctcttgttatatct
ataggtcccctctttggctggaaacaaccagccccagaagatgagaaaatctgccaaatc
aacacagatcctggttatgtgctattctctgcttttggatctttctacctccctttgatc
attatactggtgatgtactgccgggtgtatgtggtggccagaagggaaagcaaaggactt
tcttgtggcctgaaaaccgagaagtcccattcagaagaagttaccctccgcatccattgc
aaaaatgcaacagaaaccactggatctacccccagcaccaagcacaaatcccatttttcc
atgaggctgctgaagttctccagggaaaagaaagccgcaaagagcctgggaatagttgtg
ggatgcttcatcctgtgctggcttcccttctttttaatcatgcctatcggttctttcttc
cctgagagcaaaccctcggacactgtttttaaaattgccttttggcttggatatctaaac
agctgcatcaaccccatcatctacccgtgttcgagtcaagagtttaaaaaggcattccag
aatgtcctgagaggccagtgtcttccacggagatactcggccaacaaatactccctgagc
tttaaccaccatcatcccagcaaccatgttgcagagactccaaaggacgttgtctgtatt
cccgtcaactccggagagaacttctacaagatctccaaatcagatggtatctgcgagtgg
aaacttttttcgaccgtgcaaagcatgtcaaccaagagcgcaagctctaaagacaaggcc
aaagtcaagagcaaaggtttcctgagggtttgctgttgtgctgacacatcaggaagtgat
cacccaaagggtcagaaagtgcccaccattaaaatacacacaatctctatcagtgataat
ggagaggatgtctaa

DBGET integrated database retrieval system