KEGG   Anolis carolinensis (green anole): 100554406Help
Entry
100554406         CDS       T01608                                 

Definition
angiopoietin-2-like
Orthology
K05466  
angiopoietin 2
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 496 aa AA seqDB search
MWLPVCFSVSCSLLLVSGYNSFRKSIETLGKKQYQVQHGLCSYTFLLPEMDNCRSASTSY
VSNAVQRDAPLDYDDSVQRLQLLENILENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAHVLNQTSRLELQLLKHSLSTNKLEMQISDQTSE
IGKLQEKNSFLEKKVLEMEDKHTVQLQSIKVEKDKLQSLVSRQNSIIEELQQQLVTATAN
NSLLQKQQHDLRETVQNLFSIVSTPNPSKNALVAGDEQINFKDCTEAFKSGLTTSGIYTL
TVPNTGEEKKAYCDMENSGGGWTIIQRRSDGSVDFDRTWEEYKTGFGNPSAEHWLGNELV
YQLTNQKQYALKIYLKHWEGNEAYSLYEHFYLANEEQKYRINLKGLTGTAGKISSISQPG
NGFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGVYFPMRQNTNRFKGIKWYYWKGA
GYSLKATVMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcctgtttgtttttctgtgagctgcagtcttcttctagtttcaggatacaac
tcatttcggaaaagcatagagaccctaggcaagaaacaatatcaagtccaacatggattg
tgtagctatacttttctcctgcctgagatggacaactgtcgatcggcttcaacttcctat
gtctcaaatgcagtccagagggatgcacccttagattatgatgattccgtacaaaggctt
cagcttcttgaaaacatcctggaaaacaacactcaatggctaatgaagcttgaaaattat
atccaagataacatgaaaaaagaaatggtagaaatccagcagaatgcagtgcaaaaccag
acagcggtaatgattgaaataggcacaaaccttttaaatcaaacagcagaacaaacccgg
aaattaacagatgttgaagcacatgtattgaatcaaacatcaagacttgaacttcaactt
ctaaaacattcactttcaaccaacaaacttgaaatgcagatttcagatcagaccagtgag
attggtaaactgcaagaaaaaaacagctttttagaaaaaaaagtccttgaaatggaagac
aagcacacagtccagctacagtcaataaaagtcgaaaaagataagctccagtcgctagtt
tccaggcagaactccatcattgaagaactgcagcaacagctggtcactgccacagctaac
aactctcttctgcaaaaacagcagcatgatttgagggagactgtgcagaacctgttttcc
attgtttctacaccaaatccatccaagaatgctttggtggctggagatgaacagatcaat
ttcaaggactgtactgaagccttcaaatcaggacttacaaccagcggcatctatacatta
acagtgcctaatacaggagaggagaaaaaggcatattgtgatatggaaaacagtggagga
ggctggacaataattcagcggcgctcagacggcagtgtagactttgaccgaacctgggaa
gagtacaaaacgggatttgggaatccttctgcagaacactggctgggaaatgagttggtg
tatcaactaaccaaccagaagcagtatgctcttaaaatatacttgaaacactgggaagga
aatgaggcatattccttatacgaacatttttatctagcaaatgaagaacaaaaatacagg
atcaaccttaaaggacttacgggcacagccggcaaaataagcagcataagccagccagga
aatggttttagcacaaaggatgcagacaatgacaaatgtatctgcaaatgttcacaaatg
ttaacaggaggatggtggtttgatgcatgtggtccgtccaatctgaatggagtgtacttt
ccaatgcgacagaacacaaacagatttaaaggaattaagtggtactactggaaaggagca
ggctattctctcaaggccacagttatgatgatccgaccagcagatttctaa

DBGET integrated database retrieval system