KEGG   Anolis carolinensis (green anole): 100554406Help
Entry
100554406         CDS       T01608                                 

Gene name
angpt2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
acs04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100554406 (angpt2)
Cytokines and growth factors [BR:acs04052]
 Growth factors
  Growth factors (RTK binding)
   100554406 (angpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fibrinogen_C DivIC SlyX
Motif
Other DBs
NCBI-GeneID: 100554406
NCBI-ProteinID: XP_003215490
Ensembl: ENSACAG00000009115
UniProt: G1KIK8
Position
1
AA seq 496 aa AA seqDB search
MWLPVCFSVSCSLLLVSGYNSFRKSIETLGKKQYQVQHGLCSYTFLLPEMDNCRSASTSY
VSNAVQRDAPLDYDDSVQRLQLLENILENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAHVLNQTSRLELQLLKHSLSTNKLEMQISDQTSE
IGKLQEKNSFLEKKVLEMEDKHTVQLQSIKVEKDKLQSLVSRQNSIIEELQQQLVTATAN
NSLLQKQQHDLRETVQNLFSIVSTPNPSKNALVAGDEQINFKDCTEAFKSGLTTSGIYTL
TVPNTGEEKKAYCDMENSGGGWTIIQRRSDGSVDFDRTWEEYKTGFGNPSAEHWLGNELV
YQLTNQKQYALKIYLKHWEGNEAYSLYEHFYLANEEQKYRINLKGLTGTAGKISSISQPG
NGFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGVYFPMRQNTNRFKGIKWYYWKGA
GYSLKATVMMIRPADF
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgcctgtttgtttttctgtgagctgcagtcttcttctagtttcaggatacaac
tcatttcggaaaagcatagagaccctaggcaagaaacaatatcaagtccaacatggattg
tgtagctatacttttctcctgcctgagatggacaactgtcgatcggcttcaacttcctat
gtctcaaatgcagtccagagggatgcacccttagattatgatgattccgtacaaaggctt
cagcttcttgaaaacatcctggaaaacaacactcaatggctaatgaagcttgaaaattat
atccaagataacatgaaaaaagaaatggtagaaatccagcagaatgcagtgcaaaaccag
acagcggtaatgattgaaataggcacaaaccttttaaatcaaacagcagaacaaacccgg
aaattaacagatgttgaagcacatgtattgaatcaaacatcaagacttgaacttcaactt
ctaaaacattcactttcaaccaacaaacttgaaatgcagatttcagatcagaccagtgag
attggtaaactgcaagaaaaaaacagctttttagaaaaaaaagtccttgaaatggaagac
aagcacacagtccagctacagtcaataaaagtcgaaaaagataagctccagtcgctagtt
tccaggcagaactccatcattgaagaactgcagcaacagctggtcactgccacagctaac
aactctcttctgcaaaaacagcagcatgatttgagggagactgtgcagaacctgttttcc
attgtttctacaccaaatccatccaagaatgctttggtggctggagatgaacagatcaat
ttcaaggactgtactgaagccttcaaatcaggacttacaaccagcggcatctatacatta
acagtgcctaatacaggagaggagaaaaaggcatattgtgatatggaaaacagtggagga
ggctggacaataattcagcggcgctcagacggcagtgtagactttgaccgaacctgggaa
gagtacaaaacgggatttgggaatccttctgcagaacactggctgggaaatgagttggtg
tatcaactaaccaaccagaagcagtatgctcttaaaatatacttgaaacactgggaagga
aatgaggcatattccttatacgaacatttttatctagcaaatgaagaacaaaaatacagg
atcaaccttaaaggacttacgggcacagccggcaaaataagcagcataagccagccagga
aatggttttagcacaaaggatgcagacaatgacaaatgtatctgcaaatgttcacaaatg
ttaacaggaggatggtggtttgatgcatgtggtccgtccaatctgaatggagtgtacttt
ccaatgcgacagaacacaaacagatttaaaggaattaagtggtactactggaaaggagca
ggctattctctcaaggccacagttatgatgatccgaccagcagatttctaa

DBGET integrated database retrieval system