KEGG   Anolis carolinensis (green anole): 100554453Help
Entry
100554453         CDS       T01608                                 

Gene name
usp3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 533 aa AA seqDB search
MECPHLGASVCVAPAAAAFPPGSPSAWCCSVCRSNKSPWICLTCSNVHCGRYVNGHAKKH
YEDAQVSVPNHKKMEKQEKVQHTVCMDCSSYSTYCYRCDDFVVNDTKFGLVQKVRELLQN
LENSAFTADRHRKRKLLENSSLNSKLLKINGSTAAALCATGLRNLGNTCFMNAILQSLSN
IQQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNGVSLVEEFRKTLCALWQGSQAAFSP
ESLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHRELQGGFNGVSRSSVLLQENSGLSAG
GRCCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRNKRSKNQEN
GPTCTLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTA
YLRNKVDTYVEFPLRGLDMKCFLLEPENSRPENCLYDLAAVVVHHGSGVGSGHYTAYAAH
EGRWFHFNDSTVTLTDEETVLRAKAYILFYVERRRAQQQQQQQQAARAGPEKL
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcccgcacttgggagccagcgtctgcgtggcgcccgccgccgccgccttcccc
ccgggctcgccctccgcctggtgctgcagcgtgtgccggtccaacaaaagtccttggatc
tgcctcacttgctcgaatgtccactgcggaagatacgtcaatggccacgcaaagaaacat
tacgaggatgcccaggtttcggtccccaatcacaagaagatggaaaagcaggagaaagtc
caacacacggtgtgcatggattgcagtagttacagcacatactgttaccggtgtgacgac
tttgtggtcaatgacaccaagttcggcctggtgcagaaagtccgggagctgctacaaaat
ttggaaaactcagctttcacggcagaccggcacaggaagaggaaactcctggaaaactct
tctctcaacagcaaattgttaaaaataaatgggagcactgccgccgctctgtgcgccacc
ggcctccggaacctgggaaacacctgcttcatgaacgccatcctccagtcactcagcaac
atccagcagttttgctgctacttcaaggagctgccggcggtggagctgcggaacgggaag
acggccgggcggaggacctaccacacccgcagccaaggcgacaacggcgtctccttggtg
gaagagttccggaagacgctgtgcgccctgtggcagggcagccaggccgccttcagcccc
gagtcgctcttctacgtcgtctggaagatcatgcctaacttccggggctaccagcagcag
gacgcccacgagttcatgcgctacctgctggaccacctgcaccgggagctgcagggcggc
ttcaacggcgtctcccgctcctccgtcctcttgcaggagaactcgggactctccgctgga
ggccgctgctgcataaacggcgcctcgacggtcgtgacggccatcttcggcggcatcctc
cagaacgaagtcaactgcttgatatgcgggaccgaatccaggaagttcgacccattccta
gacctttcgctagatattccaagccaatttagaaataaacgtagcaagaaccaagaaaat
ggaccaacgtgtacattacgagattgcctccgcagcttcacggacctggaagaacttgac
gagacggagctctacatgtgccacaagtgcaagaagaagcagaagtccaccaagaagttc
tggatccagaaactcccgaaggtgctgtgcttgcacctgaagcgcttccactggaccgcc
tacctgaggaacaaggtggacacctacgtggagttccccctgcgaggcctggacatgaag
tgcttcctgctggagcccgaaaacagccgaccagaaaactgcctctacgacctggcggcc
gtggtggtgcatcacggttcgggggtgggctccggccactacacggcgtacgcggcgcac
gaggggcgctggttccacttcaacgacagcacggtgacgctgacggacgaggagacggtg
ctgcgggccaaggcctacatcctcttctacgtggagcgcaggcgggcacaacagcagcag
cagcagcagcaggcggccagggccggcccagagaaactttaa

DBGET integrated database retrieval system