KEGG   Anolis carolinensis (green anole): 100554502Help
Entry
100554502         CDS       T01608                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
acs  Anolis carolinensis (green anole)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100554502
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 368 aa AA seqDB search
MSLFGSTSGFGTGGTSMFGNTSTDNHNPMKDIEVTSPPDDSIGCLAFSPPVLPGNFLIAG
SWANDVRCWEVQDNGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHEAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSPTPMMTLQLPERCYCADVVY
PMAVVATAERGLIVYQLENQPSEFRRIDSPLKHQHRCVAIFKDKVNKPTGFALGSIEGRV
AIHYINPTNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPAHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHTGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgtttgggtcaacatcaggattcggaactggtggcaccagcatgtttggcaac
acatcaacagataaccacaatccaatgaaggatattgaagttacatccccgcctgatgac
agcattggttgtttggctttcagtccgccagtattgccgggtaattttcttattgcagga
tcatgggcaaatgatgtccgctgctgggaagtccaggataatgggcagactattccaaaa
gcacaacagatgcatacaggacctgtgctagatgtttgttggagtgatgatggtagcaaa
gtgttcacagcatcctgtgataaaactgccaaaatgtgggatcttaatagcaaccaggca
atacaaatagcacagcatgaagctcctgtaaagactatccattggattaaagcaccaaat
tacagctgcgtaatgaccgggagctgggataaaactttaaaattttgggatacacgatca
cctactccaatgatgactttgcagttgccggaacgatgctactgtgccgatgtagtatat
cccatggctgttgtggctactgcagagagaggcttgatagtttatcagctagagaatcaa
ccttctgaatttagaagaatagactctcctcttaaacatcagcatcgttgcgtggctatc
tttaaagacaaagtgaacaaaccaacaggatttgcccttggaagcattgaaggaagagta
gccattcattacattaatccaacaaatcctgccaaagacaacttcaccttcaaatgtcat
cgatccaatggcacgaacacatctgcacctcaggatatatatgcagtgaatggaattgcc
tttcatccagcccacggtacactagcaacggtaggatctgatggtagattcagcttttgg
gataaagatgcacggacaaagctaaaaacatcggaacaattggaccagccaatatctgct
tgttgcttcaatcatacaggcaacatatttgcatatgcttccagttatgactggtcaaag
gggcatgagttctataacccacaaaagaagaactatatttttctgcgcaatgctgctgaa
gaattaaaaccaagaaataagaagtag

DBGET integrated database retrieval system