KEGG   Anolis carolinensis (green anole): 100554517Help
Entry
100554517         CDS       T01608                                 

Definition
histone deacetylase 1-like
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Cell cycle
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:acs04330]
Cellular Processes; Cell growth and death; Cell cycle [PATH:acs04110]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 480 aa AA seqDB search
MALTQGTKRKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPYKAS
AEEMTKYHSDDYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAS
AVKLNKQQTDIAVNWAGGLHHAKKSEASGFCYVNDIVLAILELLKYHQRVLYVDIDIHHG
DGVEEAFYTTDRVMTASFHKYGEYFPGTGDLRDIGAGKGKYYAVNYPLRDGIDDESYEAI
FKPVMSKVMETFQPSAVALQCGSDSLSGDRLGCFNLTIKGHAKCVEFIKSFNLPMLMLGG
GGYTIRNVARCWTYETAVALNTEIPNELPYNDYFEYFGPDFKLHISPSNMTNQNTNEYLE
KIKQRLFENLRMLPHAPGVQMQPIPEDAVPEDSADEDEEDPDKRISIRSSDKRIACDEEF
SDSEDEGEGGRKNVANFKKAKRAKTEEEEKEEEKKEVKEEDKAKEETVEPKGIKEETKST
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgactcaggggaccaagcggaaagtctgctactattatgacggggacattgga
aactactattatggccaaggccaccccatgaagcctcacaggatcaggatgacacacaac
ctcctcctcaactacggcctttacaggaaaatggagatctataggccctacaaagccagt
gctgaagaaatgaccaaataccacagtgacgactacatcaaattcctgcgctcaattcgc
ccagacaatatgtctgagtacagcaagcagatgcagcgattcaacgtcggagaggattgc
cctgtctttgatggcttgtttgagttttgtcagctttctacaggaggctcggttgccagt
gcagtgaaactgaacaagcagcagacggacatcgcagtcaattgggcaggaggcttgcat
cacgccaagaaatctgaggcctcaggcttctgctacgtcaacgacattgttttggccatt
ttggagttgctcaagtaccaccagagagtgctgtatgtggacatcgacatccaccacggc
gacggtgtggaggaggcgttctacaccacagaccgcgtgatgacggcgtccttccataaa
tatggcgaatactttcctggaacaggagacctgcgggacattggtgcaggcaaagggaag
tactacgccgtcaattatcctctcagggatggaatcgatgacgaatcttatgaagccatt
ttcaagccggtgatgtccaaagtcatggagacgttccagccgagcgctgtggccttgcag
tgtggctccgactccttgtcgggggacagattaggctgcttcaatcttactattaaaggt
cacgccaagtgtgtggagttcataaaaagctttaacttgccaatgctaatgcttggagga
ggcggctacaccatccgcaacgtggcccggtgctggacgtacgagactgccgtggccctg
aacacggagatcccaaatgagcttccttacaacgattacttcgaatactttggcccggac
ttcaagctccacatcagcccttccaacatgacgaaccaaaacaccaacgagtacctggag
aagattaagcagcgtctctttgagaacctgcggatgcttcctcacgctccgggggtccag
atgcagcccattccagaagacgctgtgccagaagatagtgcggatgaagacgaggaagat
cccgacaagcggatttccatccgctcctcggataagaggatcgcgtgcgatgaggaattc
tcagattccgaggacgaaggcgaaggcgggcgcaagaacgtggccaacttcaagaaggcc
aagcgcgcaaagactgaggaggaggagaaagaggaagagaagaaagaagtcaaggaagaa
gataaagcgaaagaagaaacggtggagcccaaaggcatcaaggaggagacaaagtcgacc
taa

DBGET integrated database retrieval system