KEGG   Anolis carolinensis (green anole): 100554557Help
Entry
100554557         CDS       T01608                                 

Gene name
dck
Definition
deoxycytidine kinase
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    100554557 (dck)
   00240 Pyrimidine metabolism
    100554557 (dck)
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     100554557 (dck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 256 aa AA seqDB search
MATPPKRTRAEKSIKKIAIEGNIAAGKSTFVNLLKQAGEEWDVVPEPVARWCNVQNCQDE
CEELSDSQKCGGNLLQMMYEKPERWSFTFQSYACLSRIRAQLKSLEGKIKEAENPVVFFE
RSVYSDRYIFASNLYESDCMNETEWTIYQDWHNWMNQQFGSCLELDGIIYLRATPEKCLN
RIYVRGRDEEQGIPIEYLEKLHYKHESWLQHRTLRMDFEYLQELPILTLDVNEDFKGNKD
RHENMIEKVKEFLSTL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccacccaagcggacccgggcggagaagagcatcaagaagatcgccattgaa
ggcaatatagctgcaggcaagtcaacctttgtgaatcttctcaaacaagccggagaagag
tgggatgttgttccagagccagtggcaagatggtgcaatgttcagaactgccaggatgaa
tgtgaggagctctcagactcacagaagtgtggtggcaacttactccaaatgatgtatgag
aagccagagagatggtctttcactttccagtcctatgcctgtctaagcagaatccgggct
cagctcaaatctcttgaggggaaaatcaaagaagctgagaaccccgtagtcttttttgag
agatctgtttacagtgacagatacatttttgcatctaatctgtatgaatctgactgtatg
aatgaaacggagtggactatttaccaagactggcacaactggatgaaccaacagtttgga
tcatgtcttgaactggatggcattatttatctccgagcgactcctgagaaatgcttgaat
aggatttatgtgcgtggaagggacgaagaacaaggcattcccatagaatacctcgaaaag
cttcattacaaacatgagagctggctccagcataggactttacgaatggattttgaatat
ttgcaagaattaccgattctaacactggatgtaaatgaagatttcaagggcaacaaagat
aggcatgaaaacatgattgaaaaggtcaaagaattcttgagcactttgtag

DBGET integrated database retrieval system