KEGG   Anolis carolinensis (green anole): 100554689Help
Entry
100554689         CDS       T01608                                 

Gene name
itga8
Definition
(RefSeq) integrin subunit alpha 8
  KO
K06584  
integrin alpha 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100554689 (itga8)
   04514 Cell adhesion molecules (CAMs)
    100554689 (itga8)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    100554689 (itga8)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100554689 (itga8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 1083 aa AA seqDB search
MALRLPPRRAISWRASARGSPRRRRRRRRRTREPPQRMGRRRRRWRGALLWLLLLLPPLG
AFNLDAEKRAVYRGPPGSYFGYALDFYSPAPSSHEVSILVGAPKANTTQPDIVEGGAVYY
CPWPATECKQIPFDGTNNRKIKVNGTREPIEFKSNQWFGATVRAHKGKVVACAPLYHWRT
LKAAPEKDPVGTCYVAIQNFSAYAEYSPCRNNNPDPEGQGYCQAGFSLDFYKNGDLIVGG
PGSFYWQGQIITSSVADIITDYSFKNILRKLSQEKQTGVAPSVYDDNYLGYSLAVGEFTG
DFQQELVAGVPRGAQNFGYVSIINSTDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDI
LIGAPLFMEREFESNPKEVGQVYLYLQDSTLSFRDAQILSGTEVFGRFGNAIAHLGDLNQ
DGYNDIAIGAPFAGEERRGKVLIYNGASNGLNPNPSQVLSSMWASQPMPAGFGFTLRGDS
DIDKNDYPDLIVGAFGAGKVVVYRARPVVTVDARVLLSPEIINPENKTCQLPGSAALVSC
FTVNVCVAFEAPGVSDKIALKAELQLDSLKVKGAVKRTLFLDYHQSQHAFLLMIERQNWL
TCKDFVVYLRDETEFRDKLSPINVTLNYSLDESTFSDGLTVNPILNYYQENIVGKQAYIL
VDCGEDNVCIPDLKLSAVPDRDQIIIGEENYVTLIVNSRNEGEGAYEAELHIKIPPEADY
TGVERNNKALRALSCNYKMENETRTVICDLGNPIAAGANFSSGIRFTVQHFENAEFSIQF
ELQVRSSNKVNPNSNLVDLRLDINAVAQVQIRGVSHPPQIILPIHNWEPKDEPTKEDDIG
PLVEHIYELHNSGPSAINDTVLYVEWPVLSGEEFLLYILHIQTHGPLQCQTSSAINSLDI
KFSVPEDTPELAAFLRNSSIPHYVGRREAKAVEHQKNSARILNCTNVECLMITCSVGLLE
RGRSAALKIRSLLWASTFLKRKNGHYSLSVNVSFEVKKMPYKVQPAKLSEGSVAIKTSVI
WATPNISFAIPLWVIVLAILLGLLVLAMLTLALWKCGFFDRARPPRDDMADREQLTSDKT
TDT
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcctccctcctcgccgtgccatctcctggcgggcgtcggcccgaggcagc
cctcggaggaggaggcggcggcggaggaggacgagagaacccccgcagaggatggggcgg
cggcggcggcgctggcggggcgcgctcctttggctgctcctgctcctcccgccgctcggc
gccttcaacctggacgccgagaagcgcgccgtctaccgcggaccgccggggagctacttc
ggctacgcgctggacttctacagccccgcgccctcctcccacgaagtgagcatcctggtc
ggagctcctaaagccaacacgacacaaccggacatagtggaaggaggagcagtctactat
tgcccttggccggctaccgagtgtaaacagatcccttttgatggtacaaacaacaggaaa
atcaaagtgaatggcacaagagagcctatagagtttaaatcaaatcagtggtttggagca
acagtcagagctcataaaggaaaagttgtggcttgtgctcccttataccattggagaaca
ctgaaggctgcacctgaaaaagatccagttggcacttgctatgtagcaattcaaaacttc
agtgcctacgctgaatattccccttgtcgcaataacaatccagatcctgagggacaaggt
tactgtcaagcaggattcagcttagacttttataagaatggagaccttatagtaggagga
cctggcagcttttattggcaaggccagattatcaccagcagtgttgcagatattatcaca
gactattcattcaagaatatcctaaggaagctgtcacaagaaaagcaaactggagtggca
ccatcagtgtatgatgacaactatcttgggtactctttggctgtgggcgaattcactgga
gactttcaacaagaattggtagctggagtcccaagaggtgcacagaactttggctatgtt
tcaattataaactccaccgatttgacctttattcagaatttcactggtgaacagatggca
tcttactttggatatacggttgcagtgtccgatgttaacaatgacgggctggatgacatt
ctcatcggagcacctctttttatggagcgtgaatttgagagcaatcctaaagaagtgggg
caagtgtatctttatctgcaagacagcaccttgtccttcagagacgcacagatactatct
ggcacggaagtgtttggtagatttggcaatgccattgcacaccttggggacctgaaccag
gatggatataatgacattgcaataggcgctccattcgccggagaagagcggagggggaaa
gtactcatttacaacggagctagtaatgggttaaacccaaacccttcccaggttctcagc
agtatgtgggcctcccagccaatgcctgcgggatttggctttacgctaagaggagactca
gacatagacaagaatgattacccagatttaattgtgggggcttttggagctggaaaagtc
gttgtttacagagcaagaccggttgtgacagtagatgctcgagtcttgctctcaccagag
attataaatccggaaaataaaacctgtcagcttcctggttctgcagctctagtttcttgt
tttactgtaaacgtatgtgtggcttttgaagctccaggtgtttcagataaaatagctctg
aaagctgagctgcagttggattctttaaaagtcaaaggagctgttaagcggacccttttc
ctggattaccatcagtcacagcatgccttcctcctcatgatagagcggcagaactggctc
acttgtaaggactttgtggtttatctcagagatgaaactgagtttcgagataaattatct
ccaatcaacgttaccttgaattacagcttggacgaatctactttttcagacggcttaact
gtgaacccaatactgaactattaccaagaaaacattgttggcaagcaggcttacattctt
gtggattgtggagaggacaacgtgtgcattcctgacttgaaactttctgctgtgccagac
agagatcagatcataattggggaagaaaactatgtcaccctaattgtcaattcaagaaat
gaaggtgaaggagcctatgaagcagagctgcatataaagatacctcctgaagcagattac
acaggtgttgaacgcaacaacaaggcactccgtgcgctgagctgtaattacaagatggaa
aatgaaacgagaacagtgatttgcgaccttgggaatcccatagcagctggagcaaatttt
tcatcaggcatcagattcactgtgcaacactttgaaaatgctgaattcagcatccagttt
gagctgcaagtgagaagttccaacaaagttaatcccaacagtaatttggttgaccttcgg
cttgacataaatgccgtcgctcaagtacagatcagaggagtttctcatcctccacaaatt
attttgccaattcataactgggagccaaaagatgaacctaccaaagaagacgacattgga
cccctggtggaacacatatacgagttgcacaacagtgggccaagcgccatcaatgataca
gtcctgtatgtggagtggccagtgctgagcggagaggaattccttctttacatcctccat
atccagactcatggaccgttgcaatgtcaaacaagctctgcaatcaacagtttagacata
aagttttctgtcccggaggacacgccggagctcgcagcttttttgcgaaactcatctatt
cctcactatgttggacggagagaagccaaagctgtggagcatcaaaagaattctgcaaga
attctgaattgcacaaatgtggaatgcttaatgatcacttgttcagtgggactcttagaa
agaggaagaagtgcagcactgaaaatacgttctcttttgtgggcttcaacatttctaaag
aggaaaaacggccactattcgctttcagtcaatgtgtcattcgaagtaaagaagatgcca
tacaaagttcaaccggcaaaactctctgaaggaagcgtagcaattaaaacatctgttatt
tgggctactccaaacatttcctttgcaatcccactgtgggttatagttttagccatactc
cttggcttgctggtcctggctatgttgacactagctttgtggaagtgtggcttctttgat
cgagccaggcctcctcgagatgacatggctgaccgggaacaactaacaagtgacaagact
actgatacgtag

DBGET integrated database retrieval system