KEGG   Anolis carolinensis (green anole): 100554689Help
Entry
100554689         CDS       T01608                                 

Definition
integrin alpha-8-like
Orthology
K06584  
integrin alpha 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:acs04512]
Environmental Information Processing; Signaling molecules and interaction; Cell adhesion molecules (CAMs) [PATH:acs04514]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:acs04810]
Cellular Processes; Cell communication; Focal adhesion [PATH:acs04510]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1081 aa AA seqDB search
MALRLPPRRAISWRASARGSPRRRRRRRRRTREPPQRMGRRRRRWRGALLWLLLLLPPLG
AFNLDAEKRAVYRGPPGSYFGYALDFYSPAPSSHDILVGAPKANTTQPDIVEGGAVYYCP
WPATECKQIPFDGTNNRKIKVNGTREPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLK
AAPEKDPVGTCYVAIQNFSAYAEYSPCRNNNPDPEGQGYCQAGFSLDFYKNGDLIVGGPG
SFYWQGQIITSSVADIITDYSFKNILRKLSQEKQTGVAPSVYDDNYLGYSLAVGEFTGDF
QQELVAGVPRGAQNFGYVSIINSTDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDILI
GAPLFMEREFESNPKEVGQVYLYLQDSTLSFRDAQILSGTEVFGRFGNAIAHLGDLNQDG
YNDIAIGAPFAGEERRGKVLIYNGASNGLNPNPSQVLSSMWASQPMPAGFGFTLRGDSDI
DKNDYPDLIVGAFGAGKVVVYRARPVVTVDARVLLSPEIINPENKTCQLPGSAALVSCFT
VNVCVAFEAPGVSDKIALKAELQLDSLKVKGAVKRTLFLDYHQSQHAFLLMIERQNWLTC
KDFVVYLRDETEFRDKLSPINVTLNYSLDESTFSDGLTVNPILNYYQENIVGKQAYILVD
CGEDNVCIPDLKLSAVPDRDQIIIGEENYVTLIVNSRNEGEGAYEAELHIKIPPEADYTG
VERNNKALRALSCNYKMENETRTVICDLGNPIAAGANFSSGIRFTVQHFENAEFSIQFEL
QVRSSNKVNPNSNLVDLRLDINAVAQVQIRGVSHPPQIILPIHNWEPKDEPTKEDDIGPL
VEHIYELHNSGPSAINDTVLYVEWPVLSGEEFLLYILHIQTHGPLQCQTSSAINSLDIKF
SVPEDTPELAAFLRNSSIPHYVGRREAKAVEHQKNSARILNCTNVECLMITCSVGLLERG
RSAALKIRSLLWASTFLKRKNGHYSLSVNVSFEVKKMPYKVQPAKLSEGSVAIKTSVIWA
TPNISFAIPLWVIVLAILLGLLVLAMLTLALWKCGFFDRARPPRDDMADREQLTSDKTTD
T
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcctccctcctcgccgtgccatctcctggcgggcgtcggcccgaggcagc
cctcggaggaggaggcggcggcggaggaggacgagagaacccccgcagaggatggggcgg
cggcggcggcgctggcggggcgcgctcctttggctgctcctgctcctcccgccgctcggc
gccttcaacctggacgccgagaagcgcgccgtctaccgcggaccgccggggagctacttc
ggctacgcgctggacttctacagccccgcgccctcctcccacgacatcctggtcggagct
cctaaagccaacacgacacaaccggacatagtggaaggaggagcagtctactattgccct
tggccggctaccgagtgtaaacagatcccttttgatggtacaaacaacaggaaaatcaaa
gtgaatggcacaagagagcctatagagtttaaatcaaatcagtggtttggagcaacagtc
agagctcataaaggaaaagttgtggcttgtgctcccttataccattggagaacactgaag
gctgcacctgaaaaagatccagttggcacttgctatgtagcaattcaaaacttcagtgcc
tacgctgaatattccccttgtcgcaataacaatccagatcctgagggacaaggttactgt
caagcaggattcagcttagacttttataagaatggagaccttatagtaggaggacctggc
agcttttattggcaaggccagattatcaccagcagtgttgcagatattatcacagactat
tcattcaagaatatcctaaggaagctgtcacaagaaaagcaaactggagtggcaccatca
gtgtatgatgacaactatcttgggtactctttggctgtgggcgaattcactggagacttt
caacaagaattggtagctggagtcccaagaggtgcacagaactttggctatgtttcaatt
ataaactccaccgatttgacctttattcagaatttcactggtgaacagatggcatcttac
tttggatatacggttgcagtgtccgatgttaacaatgacgggctggatgacattctcatc
ggagcacctctttttatggagcgtgaatttgagagcaatcctaaagaagtggggcaagtg
tatctttatctgcaagacagcaccttgtccttcagagacgcacagatactatctggcacg
gaagtgtttggtagatttggcaatgccattgcacaccttggggacctgaaccaggatgga
tataatgacattgcaataggcgctccattcgccggagaagagcggagggggaaagtactc
atttacaacggagctagtaatgggttaaacccaaacccttcccaggttctcagcagtatg
tgggcctcccagccaatgcctgcgggatttggctttacgctaagaggagactcagacata
gacaagaatgattacccagatttaattgtgggggcttttggagctggaaaagtcgttgtt
tacagagcaagaccggttgtgacagtagatgctcgagtcttgctctcaccagagattata
aatccggaaaataaaacctgtcagcttcctggttctgcagctctagtttcttgttttact
gtaaacgtatgtgtggcttttgaagctccaggtgtttcagataaaatagctctgaaagct
gagctgcagttggattctttaaaagtcaaaggagctgttaagcggacccttttcctggat
taccatcagtcacagcatgccttcctcctcatgatagagcggcagaactggctcacttgt
aaggactttgtggtttatctcagagatgaaactgagtttcgagataaattatctccaatc
aacgttaccttgaattacagcttggacgaatctactttttcagacggcttaactgtgaac
ccaatactgaactattaccaagaaaacattgttggcaagcaggcttacattcttgtggat
tgtggagaggacaacgtgtgcattcctgacttgaaactttctgctgtgccagacagagat
cagatcataattggggaagaaaactatgtcaccctaattgtcaattcaagaaatgaaggt
gaaggagcctatgaagcagagctgcatataaagatacctcctgaagcagattacacaggt
gttgaacgcaacaacaaggcactccgtgcgctgagctgtaattacaagatggaaaatgaa
acgagaacagtgatttgcgaccttgggaatcccatagcagctggagcaaatttttcatca
ggcatcagattcactgtgcaacactttgaaaatgctgaattcagcatccagtttgagctg
caagtgagaagttccaacaaagttaatcccaacagtaatttggttgaccttcggcttgac
ataaatgccgtcgctcaagtacagatcagaggagtttctcatcctccacaaattattttg
ccaattcataactgggagccaaaagatgaacctaccaaagaagacgacattggacccctg
gtggaacacatatacgagttgcacaacagtgggccaagcgccatcaatgatacagtcctg
tatgtggagtggccagtgctgagcggagaggaattccttctttacatcctccatatccag
actcatggaccgttgcaatgtcaaacaagctctgcaatcaacagtttagacataaagttt
tctgtcccggaggacacgccggagctcgcagcttttttgcgaaactcatctattcctcac
tatgttggacggagagaagccaaagctgtggagcatcaaaagaattctgcaagaattctg
aattgcacaaatgtggaatgcttaatgatcacttgttcagtgggactcttagaaagagga
agaagtgcagcactgaaaatacgttctcttttgtgggcttcaacatttctaaagaggaaa
aacggccactattcgctttcagtcaatgtgtcattcgaagtaaagaagatgccatacaaa
gttcaaccggcaaaactctctgaaggaagcgtagcaattaaaacatctgttatttgggct
actccaaacatttcctttgcaatcccactgtgggttatagttttagccatactccttggc
ttgctggtcctggctatgttgacactagctttgtggaagtgtggcttctttgatcgagcc
aggcctcctcgagatgacatggctgaccgggaacaactaacaagtgacaagactactgat
acgtag

DBGET integrated database retrieval system