KEGG   Anolis carolinensis (green anole): 100554689Help
Entry
100554689         CDS       T01608                                 

Definition
integrin alpha-8-like
Orthology
K06584  
integrin alpha 8
Organism
acs  Anolis carolinensis (green anole)
Pathway
Focal adhesion
ECM-receptor interaction
Cell adhesion molecules (CAMs)
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100554689
   04514 Cell adhesion molecules (CAMs)
    100554689
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100554689
  Cell communication
   04510 Focal adhesion
    100554689
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 1081 aa AA seqDB search
MALRLPPRRAISWRASARGSPRRRRRRRRRTREPPQRMGRRRRRWRGALLWLLLLLPPLG
AFNLDAEKRAVYRGPPGSYFGYALDFYSPAPSSHDILVGAPKANTTQPDIVEGGAVYYCP
WPATECKQIPFDGTNNRKIKVNGTREPIEFKSNQWFGATVRAHKGKVVACAPLYHWRTLK
AAPEKDPVGTCYVAIQNFSAYAEYSPCRNNNPDPEGQGYCQAGFSLDFYKNGDLIVGGPG
SFYWQGQIITSSVADIITDYSFKNILRKLSQEKQTGVAPSVYDDNYLGYSLAVGEFTGDF
QQELVAGVPRGAQNFGYVSIINSTDLTFIQNFTGEQMASYFGYTVAVSDVNNDGLDDILI
GAPLFMEREFESNPKEVGQVYLYLQDSTLSFRDAQILSGTEVFGRFGNAIAHLGDLNQDG
YNDIAIGAPFAGEERRGKVLIYNGASNGLNPNPSQVLSSMWASQPMPAGFGFTLRGDSDI
DKNDYPDLIVGAFGAGKVVVYRARPVVTVDARVLLSPEIINPENKTCQLPGSAALVSCFT
VNVCVAFEAPGVSDKIALKAELQLDSLKVKGAVKRTLFLDYHQSQHAFLLMIERQNWLTC
KDFVVYLRDETEFRDKLSPINVTLNYSLDESTFSDGLTVNPILNYYQENIVGKQAYILVD
CGEDNVCIPDLKLSAVPDRDQIIIGEENYVTLIVNSRNEGEGAYEAELHIKIPPEADYTG
VERNNKALRALSCNYKMENETRTVICDLGNPIAAGANFSSGIRFTVQHFENAEFSIQFEL
QVRSSNKVNPNSNLVDLRLDINAVAQVQIRGVSHPPQIILPIHNWEPKDEPTKEDDIGPL
VEHIYELHNSGPSAINDTVLYVEWPVLSGEEFLLYILHIQTHGPLQCQTSSAINSLDIKF
SVPEDTPELAAFLRNSSIPHYVGRREAKAVEHQKNSARILNCTNVECLMITCSVGLLERG
RSAALKIRSLLWASTFLKRKNGHYSLSVNVSFEVKKMPYKVQPAKLSEGSVAIKTSVIWA
TPNISFAIPLWVIVLAILLGLLVLAMLTLALWKCGFFDRARPPRDDMADREQLTSDKTTD
T
NT seq 3246 nt NT seq  +upstreamnt  +downstreamnt
atggctttgcgcctccctcctcgccgtgccatctcctggcgggcgtcggcccgaggcagc
cctcggaggaggaggcggcggcggaggaggacgagagaacccccgcagaggatggggcgg
cggcggcggcgctggcggggcgcgctcctttggctgctcctgctcctcccgccgctcggc
gccttcaacctggacgccgagaagcgcgccgtctaccgcggaccgccggggagctacttc
ggctacgcgctggacttctacagccccgcgccctcctcccacgacatcctggtcggagct
cctaaagccaacacgacacaaccggacatagtggaaggaggagcagtctactattgccct
tggccggctaccgagtgtaaacagatcccttttgatggtacaaacaacaggaaaatcaaa
gtgaatggcacaagagagcctatagagtttaaatcaaatcagtggtttggagcaacagtc
agagctcataaaggaaaagttgtggcttgtgctcccttataccattggagaacactgaag
gctgcacctgaaaaagatccagttggcacttgctatgtagcaattcaaaacttcagtgcc
tacgctgaatattccccttgtcgcaataacaatccagatcctgagggacaaggttactgt
caagcaggattcagcttagacttttataagaatggagaccttatagtaggaggacctggc
agcttttattggcaaggccagattatcaccagcagtgttgcagatattatcacagactat
tcattcaagaatatcctaaggaagctgtcacaagaaaagcaaactggagtggcaccatca
gtgtatgatgacaactatcttgggtactctttggctgtgggcgaattcactggagacttt
caacaagaattggtagctggagtcccaagaggtgcacagaactttggctatgtttcaatt
ataaactccaccgatttgacctttattcagaatttcactggtgaacagatggcatcttac
tttggatatacggttgcagtgtccgatgttaacaatgacgggctggatgacattctcatc
ggagcacctctttttatggagcgtgaatttgagagcaatcctaaagaagtggggcaagtg
tatctttatctgcaagacagcaccttgtccttcagagacgcacagatactatctggcacg
gaagtgtttggtagatttggcaatgccattgcacaccttggggacctgaaccaggatgga
tataatgacattgcaataggcgctccattcgccggagaagagcggagggggaaagtactc
atttacaacggagctagtaatgggttaaacccaaacccttcccaggttctcagcagtatg
tgggcctcccagccaatgcctgcgggatttggctttacgctaagaggagactcagacata
gacaagaatgattacccagatttaattgtgggggcttttggagctggaaaagtcgttgtt
tacagagcaagaccggttgtgacagtagatgctcgagtcttgctctcaccagagattata
aatccggaaaataaaacctgtcagcttcctggttctgcagctctagtttcttgttttact
gtaaacgtatgtgtggcttttgaagctccaggtgtttcagataaaatagctctgaaagct
gagctgcagttggattctttaaaagtcaaaggagctgttaagcggacccttttcctggat
taccatcagtcacagcatgccttcctcctcatgatagagcggcagaactggctcacttgt
aaggactttgtggtttatctcagagatgaaactgagtttcgagataaattatctccaatc
aacgttaccttgaattacagcttggacgaatctactttttcagacggcttaactgtgaac
ccaatactgaactattaccaagaaaacattgttggcaagcaggcttacattcttgtggat
tgtggagaggacaacgtgtgcattcctgacttgaaactttctgctgtgccagacagagat
cagatcataattggggaagaaaactatgtcaccctaattgtcaattcaagaaatgaaggt
gaaggagcctatgaagcagagctgcatataaagatacctcctgaagcagattacacaggt
gttgaacgcaacaacaaggcactccgtgcgctgagctgtaattacaagatggaaaatgaa
acgagaacagtgatttgcgaccttgggaatcccatagcagctggagcaaatttttcatca
ggcatcagattcactgtgcaacactttgaaaatgctgaattcagcatccagtttgagctg
caagtgagaagttccaacaaagttaatcccaacagtaatttggttgaccttcggcttgac
ataaatgccgtcgctcaagtacagatcagaggagtttctcatcctccacaaattattttg
ccaattcataactgggagccaaaagatgaacctaccaaagaagacgacattggacccctg
gtggaacacatatacgagttgcacaacagtgggccaagcgccatcaatgatacagtcctg
tatgtggagtggccagtgctgagcggagaggaattccttctttacatcctccatatccag
actcatggaccgttgcaatgtcaaacaagctctgcaatcaacagtttagacataaagttt
tctgtcccggaggacacgccggagctcgcagcttttttgcgaaactcatctattcctcac
tatgttggacggagagaagccaaagctgtggagcatcaaaagaattctgcaagaattctg
aattgcacaaatgtggaatgcttaatgatcacttgttcagtgggactcttagaaagagga
agaagtgcagcactgaaaatacgttctcttttgtgggcttcaacatttctaaagaggaaa
aacggccactattcgctttcagtcaatgtgtcattcgaagtaaagaagatgccatacaaa
gttcaaccggcaaaactctctgaaggaagcgtagcaattaaaacatctgttatttgggct
actccaaacatttcctttgcaatcccactgtgggttatagttttagccatactccttggc
ttgctggtcctggctatgttgacactagctttgtggaagtgtggcttctttgatcgagcc
aggcctcctcgagatgacatggctgaccgggaacaactaacaagtgacaagactactgat
acgtag

DBGET integrated database retrieval system