KEGG   Anolis carolinensis (green anole): 100554748Help
Entry
100554748         CDS       T01608                                 

Gene name
usp15
Definition
ubiquitin specific peptidase 15
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100554748 (usp15)
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100554748 (usp15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 1041 aa AA seqDB search
MGLPKWEGVVEGVSPVAARRHSQHAARPAPAAAAAPVTAAASSSAAVTFAAAAGAAGLGD
MAEGGAADLETQRSDITALLKTALRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDCQSLKEHLIDELDYILLPTEGWNKLVSWYTLLESQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKETRLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQRNEDGTWPRGPSAPKSPGASNFSTLPK
ISPSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRHNEQPGLCGLSNLGNTCFMN
SAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKYSYVTPRA
FKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAEE
AWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERSLEVYLV
RMDPLAKPMQYKVVVPKIGNIQDLCTALSTLSGVAADKMIVTDIYNHRFHRIFAMDENLS
SIMERDDIYVFEIGINRTEDTEQVVIPVCLREKFRHSGYSHHSGSTHFGQPFLIAVPRNN
TEDKLYNLLLLRMCRYVKTSSETEDTEASLQCCKDNGINGNGPNGIHEEGSPSEMETDEQ
DDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDSCKDQLIGHKKRLFTFQFNSLGN
TDINYVKDDTRHIRFDDRQLRLDERSFLALDWDPEYKKRFFDENAAEDFEKHESVEYRPP
KKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSYS
RYMRDKLDTLVEFPITDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDD
GKWYYFDDSSVSTASEEQIVSKAAYVLFYQRQDTISGTGFFPLDRDTKLGASAATGIPLE
SDEDSNENDNDIENENCMHTN
NT seq 3126 nt NT seq  +upstreamnt  +downstreamnt
atggggttgccgaagtgggagggggtcgtggagggcgtttccccggtcgccgcgcggcgt
cactcccagcatgcagcgcggcccgctcctgccgccgccgccgcgcctgtcaccgccgcc
gcctcttcctctgctgccgtcactttcgccgccgccgccggcgccgcggggctgggagac
atggcggagggaggcgcggcggacctggagacccagcgctcggacatcacggcgctgctg
aaaacggcgctccgcaaaggcgacacctggtatttagtggatagtcgctggttcaaacag
tggaagaagtatgttggatttgacagctgggacaaatatcaaatgggagatcagaatgtt
tatcctggtcctattgacaattctggacttcttaaagatggagattgtcagtctcttaaa
gaacatctcattgatgagttggactacattcttttaccaactgaagggtggaacaagctt
gttagctggtatacacttctggaaagccaggaaccaattgcacgcaaggtagttgaacag
ggtatgtttgtcaagcactgcaaagtagaagtatatttgacagaattaaaattgtgtgaa
aatggaaatatgaacaatgtagttacacggcgatttagtaaagctgacacaatagacaca
attgaaaaagagataaggaaaatcttcaatattccagatgaaaaagagaccaggttgtgg
aacaaatatatgagtaacacgtttgaaccgttgaataaaccagatagcaccatacaagat
gctggcttgtatcaagggcaggtgttagtgatagaacaaagaaatgaagatggaacatgg
ccaagaggcccttcagctccaaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccatctctatcaaataattataacaacatcaacaacagaaatgtgaaaaactca
aactactgtctcccctcttacactgcttataagaattatgactactctgagccaggaagg
cacaacgaacagcctggcctttgtggcctaagtaacttggggaatacatgttttatgaat
tcagcaatccagtgtctgagcaacacccctccactcacagaatacttcctgaatgataaa
tatcaagaggagctgaattttgacaatccattaggaatgaggggtgaaattgccaaatct
tatgcagagctcatcaagcaaatgtggtcaggaaaatacagttatgtcactccacgggca
tttaaaacccaggttggaagatttgctccacaattctcggggtatcagcaacaagattgc
caagaactactcgcttttcttttagatggcctacacgaggatttgaatcgaattaggaaa
aagccttatattcagctaaaagatgcagatggaaggccagacaaggtggttgctgaagaa
gcttgggagaaccatttaaagcgaaatgattccatcattgtagatatatttcatggactt
tttaaatcaaccctagtttgtccagaatgtgccaagatctctgtaacatttgatcccttt
tgctacttaactcttccactacccatgaaaaaagaacgcagtttggaagtttatttagtt
agaatggacccgcttgccaaacctatgcagtacaaagtagtagttccaaaaattggaaat
atacaagacctctgcacagcattgtcaactttgtctggtgttgctgcagataagatgata
gttacagatatatacaatcataggttccataggatatttgcaatggatgaaaatctgagt
agtattatggagcgtgatgacatctatgtatttgaaattggcatcaacagaactgaagat
acagagcaagttgtaattccagtttgtttaagggagaagtttcggcatagtggttatagc
catcatagcggttccacacattttggccaacctttccttatagcagtgcctagaaacaat
acagaagataagctgtataatcttttactcttaagaatgtgccgatacgtgaaaacctct
tctgaaacagaagacactgaagcatccttgcagtgctgcaaagataacggtatcaatggc
aatggcccaaatggaattcatgaagaaggatccccaagtgaaatggaaacagatgagcaa
gatgatgaatccagccaggatcaggaacttccttctgaaaatgaaaacagccagtcggaa
gattctgttggtggagataatgattctgagaatgggttatgcacagaagactcctgtaaa
gatcaacttatagggcacaaaaaacgattgttcacattccagtttaacagtttaggcaat
actgatatcaattatgtcaaagatgatacaaggcatatacgatttgatgacaggcaactt
aggctagatgaaagatctttcttggctttggattgggatcctgaatataagaaaagattc
tttgatgaaaatgctgctgaggattttgaaaagcatgaaagcgtggaatatagacctcca
aaaaaaccctttgtgaaattaaaagattgcattgaattgttcacaacaaaagaaaaatta
ggtgctgaagatccatggtactgtccaaactgtaaagaacatcagcaagctaccaaaaag
ctagatttgtggtcactgccgccagtattagtagttcatctaaaacgtttttcttacagc
agatatatgagagataagttggatactttggttgagttcccaataacagatttggacatg
tcagagttccttattaatccaaatgctgggccttgccgctataacttgattgctgtgtca
aaccactatggaggcatgggaggagggcattatactgcttttgcaaaaaacaaagatgat
ggaaagtggtattactttgatgatagtagtgtgtctactgcctctgaggaacagattgtg
tccaaagcagcctatgtgcttttctaccagaggcaggacacaatcagtgggactggcttt
ttccctcttgatcgggacacaaaactaggtgcttctgctgccactggcatcccattagaa
agtgatgaagacagtaatgaaaatgacaatgatatagagaatgaaaattgtatgcacact
aactaa

DBGET integrated database retrieval system