KEGG   Anolis carolinensis (green anole): 100554801Help
Entry
100554801         CDS       T01608                                 

Definition
ras-specific guanine nucleotide-releasing factor 2-like
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100554801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1217 aa AA seqDB search
MQLPRALLPFPPAPVVLLSEGELVLVLKEGGSSREGGREAALFIARAGGLEEEECVGSMH
ANEEQLSPVEVEAKFYFTVLFGHEGQKPLELRCEDEADGEEWVDAIHQASYSDILIEREV
LMQKYIHLVQIVETEKISANQLRHQLEDQDTEIERLKSEIVALNKTKERMRPYQGSQEEE
DPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRKRNQIVFNMVEAESEYVHQL
YILVNCFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLHEIFHQGLKARIANWPTLIL
ADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLLKQYEANPACEGRMLETFLT
YPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELSRVMHDEVSETENIRKNLAI
ERMIVEGCDILLDTSQTFIRQGTLIQVPSVERGKLSKVRLGSLSLKKEGERQCFLFTKHL
LICTRSSGGKLHLLKAGGVLSLIECTLIEETDMNDEDSKNSGQVFGHLDFKIVVEPADAP
PFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVFEENSKVTVPHMIKSDARLHKDD
TDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLNTFLHTYRIFTTANVVLEKL
SDIYKRPFTSIPVRSLELFFATNQNNRDHLVDAKSPHLCRKFSSPPPLSLSRTSSPVRTR
KLSLSSPLNSRIGALDLSTTSSLASSPTSTYSPATSPPPTLPKVPLDLSKGPSSPEQNSN
FVDENSENPRMELCNKLRRSLRRAVLESVSVDRTIPESASSVDSPELSPCRSPSTPRHLR
YRQSGVQVTDNSHCSVSPASAFAIATAAAGHGSPSGFNNSERMCDKEFIIRRAATNRVLN
VLRHWVSKHSQDFELYNELKMNVLNLLEEVLRDPDLLPQERKATANILRALSQEDQDDNH
LKIEDIMQTLECPKPECFETLSAMELAEQITLLDHIVFRSIPYEEFLGQGWMKLDKIERT
PYIMKTSQHFNDMSTLVASQIMNYADVGSRANAIEKWVAVADICRCXHNYNGVLEITSAL
NRSAIYRLKKTWAKVSKQTKALMDKLQKTVSSEGRFKNLRETLKNCNPPSVPYLGMYLTD
LAFIEEGTPNFTEEGLVNFSKMRMISHIIREIRQFQQTSYRIDHQPKVTQYLLDKSLIID
EDTLYELSLKIEPRLPA
NT seq 3654 nt NT seq  +upstreamnt  +downstreamnt
atgcagctgcctagggctctccttcccttccctcctgctcctgtggttcttctctccgag
ggggaacttgtccttgtccttaaggagggtggcagcagcagagaaggtggaagagaagct
gctctcttcattgcaagggccggaggcctggaagaagaggaatgtgttggctccatgcac
gccaatgaggagcagctaagtcccgtggaggtggaagccaagttctacttcactgtcctt
tttggccatgaaggacagaaaccacttgagctccgctgtgaagatgaagcagatggagaa
gaatgggtagatgctattcaccaggcgagttactcagatatcttaattgaaagggaggta
ttaatgcaaaaatacatacatctagttcagattgtagagacagaaaagatctcagccaat
cagctgcgacatcaacttgaggatcaagacacagaaattgaaaggcttaaatcagagatt
gtagctctcaataaaactaaagaacgtatgcgaccttatcaaggcagccaagaagaagaa
gatccagatatcaaaaaaattaaaaaggttcagagttttatgcgaggttggttgtgcaga
agaaagtggaagacaattgtccaagattatatttgttctcctcatgcagagagcatgcgg
aagaggaatcaaattgttttcaacatggttgaggctgaatcggaatatgtgcatcaactt
tacattcttgttaattgttttctaagacccttaagaatggccgcaagctcaaagaagcca
cccattagtcatgatgatgtcagcagcatatttctcaacagtgaaactataatgttcttg
catgaaatatttcatcaaggattaaaagcaagaatagcaaattggccaactctaatttta
gctgatttatttgacatcttgctaccaatgctgaatatttatcaagaatttgttagaaat
caccagtacagtcttcaagttttagcaaactgcaaacagaatagagattttgacaaactt
ttgaagcaatatgaagccaaccctgcatgtgagggcaggatgcttgaaactttcctcact
tatcccatgtttcagatccctagatatattataactcttcatgaacttctggctcataca
ccacatgaacacgtggaaagaaaaagccttgaatttgctaaatccaagttagaagaactt
tcaagagtgatgcatgatgaagttagtgaaacagaaaacatacggaaaaaccttgcaata
gaaaggatgatcgtagagggttgtgacatattactggataccagtcaaacttttatacga
caaggtactctcattcaagtcccttcagttgagagggggaaacttagtaaagttcgtctg
ggatcattgtctttgaaaaaagaaggagaaagacaatgtttcttatttacaaaacactta
ttaatttgtacaagaagttctggaggaaagctgcatctgcttaaggcaggaggtgtcctt
tcgctaatagaatgcacactaattgaggaaactgatatgaatgatgaggactcaaaaaat
tctggacaggtgtttggacaccttgacttcaagatcgtggtggaaccagcagatgcacct
ccttttacagttgtcttgttagctccttcgagacaggaaaaagcagcatggacaagcgac
attagtcagtgtgttgacaacatacgctgtaatggtttaatgaccatagtatttgaagaa
aactccaaagtcactgtgccacatatgatcaaatctgatgctcgtcttcacaaggatgac
actgacatctgcttcagcaaaacactaaattcctgcaaagtgccccagattcgttatgca
agcgtagaacgccttttggagagattaacagacttgcgattcctcagtattgatttcctt
aatactttcctacatacttaccgcatatttactactgcaaatgttgtactggagaaactg
tcagatatatacaaacggcctttcacctcaatcccagttcgatctttggagttgtttttt
gctactaatcaaaacaacagagatcatttggttgatgcaaaatcaccacacctctgtcgc
aaattctcttctcctccaccgctgtcactctcgaggacttcctcgcctgtcagaaccaga
aaactgtcattaagctctccactaaattcaagaataggagctttagacctgtctactacc
tcctctcttgctagcagtcctacctcaacgtatagccctgctacatcaccacctcccact
ttgcctaaagtacccctagacctgagcaaagggccttcatctccagaacaaaattctaat
tttgtcgatgagaactcagagaatccacgtatggagctttgcaacaaactgagaagaagc
cttcgaagagcggttctggagtctgtatcagtggaccgtacaatcccagaaagtgcctca
tccgtggatagccctgagctctccccatgtagatctccttcaactccaaggcatttgcgc
tatcgacagtcaggggtacaggtgactgacaacagccattgttctgtttcccctgcttct
gcctttgctattgctactgcggcagctggacatggcagtccatcaggatttaataactct
gaaagaatgtgtgataaggagttcatcatacgccgagcagccacaaatcgtgtcctgaat
gtccttcgccattgggtctcaaaacattcccaggatttcgagctatacaatgaactgaaa
atgaatgttctaaatcttctagaagaagtgttgagggaccctgacctgctgccacaagaa
agaaaagctacagcaaacatattgagggcactttcccaggaagatcaagatgacaatcac
ttaaaaatagaggacatcatgcagacgttagaatgtcctaaaccagagtgctttgaaacg
ctatcagccatggagcttgctgaacaaataactctcttagatcacattgttttcagaagc
ataccctatgaagagtttcttgggcagggttggatgaaattggacaaaattgaaagaaca
ccttatattatgaaaaccagccaacactttaatgatatgagcacccttgttgcatcccag
attatgaattatgcggatgttggctcacgtgcaaatgcgattgagaaatgggtagcagtg
gcagacatctgccgatgtntgcacaactacaatggtgtgttggaaatcacatcagccttg
aacagaagtgcaatctacaggctgaagaaaacctgggctaaagtttctaaacagactaag
gctcttatggataaacttcagaagactgtatcatctgaaggaaggtttaaaaatctcaga
gaaacactcaagaactgtaatcccccttctgtaccatatcttggaatgtacctaacagac
ctggcatttattgaagaaggaacaccaaattttactgaagaaggccttgttaatttttcc
aaaatgagaatgatatcacatataatcagggaaatacggcaattccagcagacgtcttat
cgcatagatcatcaaccaaaggtcactcagtacttacttgacaagagtctcatcatagat
gaagacacattgtatgaactatctctaaagattgaacccagattgcctgcctga

DBGET integrated database retrieval system