KEGG   Anolis carolinensis (green anole): 100554816Help
Entry
100554816         CDS       T01608                                 

Definition
ubl carboxyl-terminal hydrolase 18-like
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100554816
Peptidases [BR:acs01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100554816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 387 aa AA seqDB search
MGQNFAMQKRSKTLQLDEYQTITAEDEKDGEEKEERKEDIMEKYNKKLKAICGLADLRNG
AVGLYNIGLNCCLNSLLQVFFMNRFFTMILRRIKVPFDVDEQKASVPYQMLLLLEQMQQS
KQKSVHPMNLVQCLSKHDVKLFVLYDAAELFLILWNLIKDQITSTDLAERLTHQYTIRLK
EHLTCQECSYETKKDSNLIMLPLHLSDSDSHAFKKLEDALHYFFASEQMMEESTFCCEQC
NRKAPRLRGVKVTYLPQTLTLHLKRFTSNERHRTRKIYNSLSFPQSLDFSQILTPEQYCP
DIQEKDDGLYDLFAVVPHSGSADFGHYCAYVWSLTEHKWYCFNDSSVCQVFWDDIKCTYG
RASLRWGETAYLLVYMKKNCKALWSDL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaactttgcaatgcaaaaaagaagtaaaacactccagctggacgaatatcag
accattacagccgaggatgagaaggatggggaagaaaaagaagaacgcaaagaggatatt
atggagaagtacaacaagaaactcaaagctatttgcggcctggctgacttaagaaatgga
gctgttggcttgtacaatattggattaaactgctgcctcaattccttgctgcaagttttc
ttcatgaacagattcttcactatgattctgcggaggattaaagtgccctttgatgttgat
gaacagaaagcaagtgttccttaccagatgcttcttctcttggagcagatgcagcagagc
aaacagaagtctgtacatcccatgaatctcgtccagtgcctctcaaaacacgatgtgaaa
ttgtttgttctttatgatgctgctgaacttttcctgatcctatggaatctaattaaggac
caaatcacaagcacagatttggctgaaagactcactcatcagtacactattcgactgaag
gaacatctaacatgccaggagtgttcgtatgaaacaaagaaggacagcaacctgataatg
cttcctctccacttgtctgattctgattctcatgcatttaagaagttggaagatgcattg
cactatttttttgcatcagaacaaatgatggaagaaagtacattttgctgtgagcaatgt
aaccggaaagcaccaagattacggggtgtgaaagtcacatatctgccacagacactcacc
cttcacctgaaacggttcacctccaatgaaagacatcgaactcggaaaatctacaattcc
ttatccttcccacaaagtttggatttcagccagattttgaccccagaacagtattgtccg
gatatccaggaaaaggatgatgggctgtatgatctttttgctgttgttccacattcggga
tcggctgactttggtcattattgtgcctatgtttggagcctcacagaacacaaatggtat
tgtttcaatgattccagtgtctgtcaggtattctgggatgatatcaaatgtacctatgga
agagcatctctccgttggggagaaacagcctatctcttggtttacatgaaaaagaattgc
aaggcgctctggtcagatttatga

DBGET integrated database retrieval system