KEGG   Anolis carolinensis (green anole): 100554816Help
Entry
100554816         CDS       T01608                                 

Definition
ubl carboxyl-terminal hydrolase 18-like
Orthology
K11846  
ubiquitin carboxyl-terminal hydrolase 18/41 [EC:3.1.2.15]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 387 aa AA seqDB search
MGQNFAMQKRSKTLQLDEYQTITAEDEKDGEEKEERKEDIMEKYNKKLKAICGLADLRNG
AVGLYNIGLNCCLNSLLQVFFMNRFFTMILRRIKVPFDVDEQKASVPYQMLLLLEQMQQS
KQKSVHPMNLVQCLSKHDVKLFVLYDAAELFLILWNLIKDQITSTDLAERLTHQYTIRLK
EHLTCQECSYETKKDSNLIMLPLHLSDSDSHAFKKLEDALHYFFASEQMMEESTFCCEQC
NRKAPRLRGVKVTYLPQTLTLHLKRFTSNERHRTRKIYNSLSFPQSLDFSQILTPEQYCP
DIQEKDDGLYDLFAVVPHSGSADFGHYCAYVWSLTEHKWYCFNDSSVCQVFWDDIKCTYG
RASLRWGETAYLLVYMKKNCKALWSDL
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggacaaaactttgcaatgcaaaaaagaagtaaaacactccagctggacgaatatcag
accattacagccgaggatgagaaggatggggaagaaaaagaagaacgcaaagaggatatt
atggagaagtacaacaagaaactcaaagctatttgcggcctggctgacttaagaaatgga
gctgttggcttgtacaatattggattaaactgctgcctcaattccttgctgcaagttttc
ttcatgaacagattcttcactatgattctgcggaggattaaagtgccctttgatgttgat
gaacagaaagcaagtgttccttaccagatgcttcttctcttggagcagatgcagcagagc
aaacagaagtctgtacatcccatgaatctcgtccagtgcctctcaaaacacgatgtgaaa
ttgtttgttctttatgatgctgctgaacttttcctgatcctatggaatctaattaaggac
caaatcacaagcacagatttggctgaaagactcactcatcagtacactattcgactgaag
gaacatctaacatgccaggagtgttcgtatgaaacaaagaaggacagcaacctgataatg
cttcctctccacttgtctgattctgattctcatgcatttaagaagttggaagatgcattg
cactatttttttgcatcagaacaaatgatggaagaaagtacattttgctgtgagcaatgt
aaccggaaagcaccaagattacggggtgtgaaagtcacatatctgccacagacactcacc
cttcacctgaaacggttcacctccaatgaaagacatcgaactcggaaaatctacaattcc
ttatccttcccacaaagtttggatttcagccagattttgaccccagaacagtattgtccg
gatatccaggaaaaggatgatgggctgtatgatctttttgctgttgttccacattcggga
tcggctgactttggtcattattgtgcctatgtttggagcctcacagaacacaaatggtat
tgtttcaatgattccagtgtctgtcaggtattctgggatgatatcaaatgtacctatgga
agagcatctctccgttggggagaaacagcctatctcttggtttacatgaaaaagaattgc
aaggcgctctggtcagatttatga

DBGET integrated database retrieval system