KEGG   Anolis carolinensis (green anole): 100554830Help
Entry
100554830         CDS       T01608                                 

Gene name
ADH7B
Definition
alcohol dehydrogenase 1-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100554830 (ADH7B)
  Lipid metabolism
   00071 Fatty acid degradation
    100554830 (ADH7B)
  Amino acid metabolism
   00350 Tyrosine metabolism
    100554830 (ADH7B)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100554830 (ADH7B)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100554830 (ADH7B)
   00982 Drug metabolism - cytochrome P450
    100554830 (ADH7B)
Enzymes [BR:acs01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100554830 (ADH7B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 376 aa AA seqDB search
METTGKIIKCKAAVAWEIGKPLSIEEIEVAPPKSHEVRVKIIATGICGTDDHVLSGSFPK
VNYPVIPGHEGAGIVESVGEGVTGLNPGDKVIPLCLPQCGECSSCLKSNTNCCLKTHLNE
PQNLMPDKTSRFTCKGKLIHHFLWISTFSEYTVMPDSTVVKIDAAAPLDKVCLFGCGFST
GYGAALNTAQVMPGSTCAIFGLGGVGLSVVMGCKAAGASRIIGIDINKDKFLKAKELGAT
ECLNPQDYKKPIQELLVEMTGHGVDYAFEVVGCLDTLTAALASCHLGCGVCVMVGVPPLG
SRLTFDPMLLFTGRTLKGCFIGGWKMKDSIPQLVSSYMEKKFNSDALISHTLPFSQISEG
FNLLHSGKSIRIVLVF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaaactacagggaaaattataaaatgtaaggctgcagtcgcctgggaaataggcaag
ccactttctattgaagagatagaagttgctccaccaaagtctcatgaagttcgcgtcaag
ataatagccacgggaatatgtgggaccgacgaccacgttctgtcaggttctttccccaaa
gtcaattatcctgttatcccaggccacgaaggagctggaattgtagagagtgttggcgaa
ggagtgactggcctaaatccaggagacaaagtcatcccactttgtttgcctcagtgcgga
gaatgtagctcatgtctaaaatctaataccaattgttgcctgaaaacccacctcaatgaa
cctcagaatctgatgccagacaaaactagccggtttacctgcaaaggaaagctaatccac
cacttcctttggatcagcactttctccgaatacactgtcatgcctgactctaccgtagtt
aaaattgatgctgctgctccattggataaagtctgcctctttggctgtgggttttccacc
ggttatggggctgccctcaatacagctcaggtcatgcctggctccacttgtgccatcttt
ggtttgggaggagtgggtctttctgtggtcatgggctgcaaagctgctggagcttcccgg
atcattgggattgacatcaacaaagacaaatttctgaaagcaaaagaattgggagccaca
gagtgtcttaacccgcaagattacaagaagcccattcaggagttactggttgaaatgact
ggtcatggtgtcgactatgcatttgaggtcgttggatgtttagatacattgacagctgcg
ctggcctcttgtcacctgggttgtggcgtctgtgtgatggttggggtgcctcctttgggc
tctcgactcaccttcgatcctatgctgctttttacaggacgtacattgaaagggtgtttc
attggagggtggaagatgaaagattctatccctcaactggtatccagttacatggagaag
aaatttaactcagatgctttgataagccacactttgccattcagccaaattagtgaaggg
ttcaatttgcttcactctggaaagagtattcgtattgtcctagtgttttaa

DBGET integrated database retrieval system