KEGG   Anolis carolinensis (green anole): 100554852Help
Entry
100554852         CDS       T01608                                 

Definition
acetyl-coenzyme A synthetase 2-like, mitochondrial-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100554852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100554852
   00620 Pyruvate metabolism
    100554852
   00640 Propanoate metabolism
    100554852
Enzymes [BR:acs01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     100554852
Lipid biosynthesis proteins [BR:acs01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   100554852
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 644 aa AA seqDB search
MPEVTSFPGPVDHQGLYQVSVEQTEAFWGALARSRLSWISPFHSVSNCNLQQGHVSWFLG
GQLNVAVNCLDRHVHQAPNKVALIWEKDEPGQEERITYRELLEKTCRLANTLKRQGVKKG
DRVVIYMPPCPMAVMSMLACARIGAIHTVVFAGFSSVALADRIQDAKSETVITVNQSIRG
GKVVELKQTVDQAIKMCPMVKRVFVSKRTDAKVSMSAVDIPLEQEMAKEDANCAPVALES
EDFLFLLYTSGSTGKPKGLVHSQGGYLLYVALTHKYVFDYHDGDVFCCVADIGWITGHSY
VVYGPLCNGATTVLFESTPLYPNPGRYWETVERLKINQFYGAPTAIRLLLSHGDNWVKKY
DRSSLKILGSVGEPINTEAWEWFFNVVGNGQCPVVDTWWQTETGGICIAPRPSNPGDEIL
PAMAMRPFFGIRPSILDDKGNVLTQNDISGALCISQAWPGMARTIYNDHQRFLETYLKPY
PGYFFTGDGAYRTSKGYYQLTGRLDDVINVSGHRLGTAEIEDVLNKHEAVAESAVIGYPH
KVKGEGVYAFVMLKEDCSLSQESLVSELRGLVSKEIAKYAAPEYIQISQHLPKTRSGKIM
RRVLKKIIENKADELGDLTTLDDHETVKEIIEGHGQLLQKEQGR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtcacatcttttcctggaccagtggaccaccaagggctgtatcaggtgtca
gtggagcaaacggaggccttctggggagcactagcaagaagccgactttcgtggatcagt
ccttttcattctgtcagtaactgtaacctacagcaaggccacgtgtcctggttcctggga
ggacagctgaatgtagctgtcaactgcttggaccgacatgtccaccaagctccaaataaa
gtggccctgatctgggagaaagatgaacctgggcaagaggaacgaattacatacagagaa
ctgctggagaagacctgtcgccttgccaacaccttgaagcgacagggagtgaagaagggt
gacagagttgtaatttacatgcctccatgtccaatggctgtgatgagtatgctggcctgt
gcccggattggagcaatacacacagtggtttttgctggattcagttctgttgctttggca
gacaggatccaagatgcaaaatccgaaactgtgatcacagtaaaccaaagcatccgaggg
gggaaagtggtggaattgaagcagacagttgaccaagctattaaaatgtgtccaatggtg
aagcgagtttttgtttcaaagagaactgatgccaaagtttcaatgtcagcagtggatatt
ccactagagcaggagatggcgaaagaggatgcaaactgtgcgccggttgccttggagagt
gaagatttcttgttccttctctatacatcaggaagtactgggaagcccaaaggactggtc
cactcacaaggaggctacttgctatatgttgctctcacacacaagtatgtgtttgactac
cacgatggagatgttttctgctgtgtggccgacattggctggatcacaggacacagttat
gtggtctatggacctttgtgcaatggagcaaccacagtactttttgagagcactccactc
tacccaaatccaggacgttactgggaaaccgtggagagattaaagataaatcagttctac
ggagcccctacagctattcgcctcctgcttagccatggagataactgggtaaagaaatat
gacagatcttccctcaaaatccttggatcagtgggagaacctatcaacacagaagcctgg
gaatggttcttcaatgtggttggaaatggacagtgcccagtagttgatacatggtggcaa
actgaaacaggaggcatctgtattgctcctcgtccttcaaaccctggagatgagatcctt
ccagctatggccatgagaccgttctttggcatccgaccttccattctggatgataaagga
aatgttttaacacagaatgatatctctggagccctctgtatatctcaagcctggccaggg
atggcaagaactatttacaatgaccaccaaaggtttttggagacctacctgaagccttac
ccaggatatttcttcactggagatggagcatatcgaactagtaaaggatattaccagctg
acaggccgccttgatgatgtcattaatgtcagcgggcaccgactgggtactgctgagata
gaagatgttctgaataagcatgaggcagtggcagagtcagccgtgattggatatcctcac
aaggtcaaaggagaaggtgtttatgcatttgtcatgttaaaggaggattgcagtctctcc
caagaaagcctggtttctgaacttcggggacttgtctcaaaagagattgcaaaatatgct
gcaccagaatatattcagataagtcagcatctgcctaagactcgctcagggaaaattatg
cggcgggttctgaagaagatcatagaaaacaaagcagatgaacttggagacttgacaact
ctggatgaccatgaaacagtgaaagagatcattgagggacatgggcaacttctgcagaaa
gaacagggccggtaa

DBGET integrated database retrieval system