KEGG   Anolis carolinensis (green anole): 100554852Help
Entry
100554852         CDS       T01608                                 

Definition
acetyl-coenzyme A synthetase 2-like, mitochondrial-like
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:acs01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:acs00010]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:acs00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:acs00640]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 644 aa AA seqDB search
MPEVTSFPGPVDHQGLYQVSVEQTEAFWGALARSRLSWISPFHSVSNCNLQQGHVSWFLG
GQLNVAVNCLDRHVHQAPNKVALIWEKDEPGQEERITYRELLEKTCRLANTLKRQGVKKG
DRVVIYMPPCPMAVMSMLACARIGAIHTVVFAGFSSVALADRIQDAKSETVITVNQSIRG
GKVVELKQTVDQAIKMCPMVKRVFVSKRTDAKVSMSAVDIPLEQEMAKEDANCAPVALES
EDFLFLLYTSGSTGKPKGLVHSQGGYLLYVALTHKYVFDYHDGDVFCCVADIGWITGHSY
VVYGPLCNGATTVLFESTPLYPNPGRYWETVERLKINQFYGAPTAIRLLLSHGDNWVKKY
DRSSLKILGSVGEPINTEAWEWFFNVVGNGQCPVVDTWWQTETGGICIAPRPSNPGDEIL
PAMAMRPFFGIRPSILDDKGNVLTQNDISGALCISQAWPGMARTIYNDHQRFLETYLKPY
PGYFFTGDGAYRTSKGYYQLTGRLDDVINVSGHRLGTAEIEDVLNKHEAVAESAVIGYPH
KVKGEGVYAFVMLKEDCSLSQESLVSELRGLVSKEIAKYAAPEYIQISQHLPKTRSGKIM
RRVLKKIIENKADELGDLTTLDDHETVKEIIEGHGQLLQKEQGR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgccagaagtcacatcttttcctggaccagtggaccaccaagggctgtatcaggtgtca
gtggagcaaacggaggccttctggggagcactagcaagaagccgactttcgtggatcagt
ccttttcattctgtcagtaactgtaacctacagcaaggccacgtgtcctggttcctggga
ggacagctgaatgtagctgtcaactgcttggaccgacatgtccaccaagctccaaataaa
gtggccctgatctgggagaaagatgaacctgggcaagaggaacgaattacatacagagaa
ctgctggagaagacctgtcgccttgccaacaccttgaagcgacagggagtgaagaagggt
gacagagttgtaatttacatgcctccatgtccaatggctgtgatgagtatgctggcctgt
gcccggattggagcaatacacacagtggtttttgctggattcagttctgttgctttggca
gacaggatccaagatgcaaaatccgaaactgtgatcacagtaaaccaaagcatccgaggg
gggaaagtggtggaattgaagcagacagttgaccaagctattaaaatgtgtccaatggtg
aagcgagtttttgtttcaaagagaactgatgccaaagtttcaatgtcagcagtggatatt
ccactagagcaggagatggcgaaagaggatgcaaactgtgcgccggttgccttggagagt
gaagatttcttgttccttctctatacatcaggaagtactgggaagcccaaaggactggtc
cactcacaaggaggctacttgctatatgttgctctcacacacaagtatgtgtttgactac
cacgatggagatgttttctgctgtgtggccgacattggctggatcacaggacacagttat
gtggtctatggacctttgtgcaatggagcaaccacagtactttttgagagcactccactc
tacccaaatccaggacgttactgggaaaccgtggagagattaaagataaatcagttctac
ggagcccctacagctattcgcctcctgcttagccatggagataactgggtaaagaaatat
gacagatcttccctcaaaatccttggatcagtgggagaacctatcaacacagaagcctgg
gaatggttcttcaatgtggttggaaatggacagtgcccagtagttgatacatggtggcaa
actgaaacaggaggcatctgtattgctcctcgtccttcaaaccctggagatgagatcctt
ccagctatggccatgagaccgttctttggcatccgaccttccattctggatgataaagga
aatgttttaacacagaatgatatctctggagccctctgtatatctcaagcctggccaggg
atggcaagaactatttacaatgaccaccaaaggtttttggagacctacctgaagccttac
ccaggatatttcttcactggagatggagcatatcgaactagtaaaggatattaccagctg
acaggccgccttgatgatgtcattaatgtcagcgggcaccgactgggtactgctgagata
gaagatgttctgaataagcatgaggcagtggcagagtcagccgtgattggatatcctcac
aaggtcaaaggagaaggtgtttatgcatttgtcatgttaaaggaggattgcagtctctcc
caagaaagcctggtttctgaacttcggggacttgtctcaaaagagattgcaaaatatgct
gcaccagaatatattcagataagtcagcatctgcctaagactcgctcagggaaaattatg
cggcgggttctgaagaagatcatagaaaacaaagcagatgaacttggagacttgacaact
ctggatgaccatgaaacagtgaaagagatcattgagggacatgggcaacttctgcagaaa
gaacagggccggtaa

DBGET integrated database retrieval system