KEGG   Anolis carolinensis (green anole): 100554859Help
Entry
100554859         CDS       T01608                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 611 aa AA seqDB search
MANAHSISHLPYFFGNITREEAEDYLIQCGLSNGLYLLRQSRNYLGGFALSLVHDSKVYH
YTIEREISGSYAISGGKSHRSPVELINYHSDEVDGLVCLLKKSCNRPPGVEPKTSQFEDL
KENLIREYVKRTWNLQGHALEQAIISQKPQLEKLIATTAHLKMPWFHGMISREESEQRVH
LGTKTNGKFLIRERDNNGSFALCLLNEGKVLHYRIDKDKKGKLSIPDGKKFDTLCQLVEH
YSYKADGLLRIITDPVPNPNFHLTNGQSDFGNTPELPKRSTNKSVFPVPGRSADSQLFND
YVPRRKRVQCADDQREALPMDTEVYESPYADPEEVKAKNVTLDRSLLILEDQELGSGNFG
TVKKGTYEMKKXVIKLAVKILKNESNDPSVKDELLREANVMQQLDNPYIVRMIGICEAES
WMLVMEMAELGPLNKYLMKHKDVTDKNIIELVHQVSMGMKYLEENNFVHRDLAARNVLLV
TQHYAKISDFGLSKALGSNDYYKAERYGKWPVKWYAPECMNFFKFSSKSDVWSFGVLMWE
AFSYGQKPYKGMKGGEVAQMLERGDRMECPPGCPPEVYELMKLCWTYNVDDRPAFSSVEL
RLRNFYYDIAQ
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgctcattctattagccacctcccctacttctttggtaacatcactcgtgag
gaagctgaggattatttgattcaatgtggattaagcaatggactgtatctactgcgacag
agccgaaactatcttggaggctttgctttgtccctggttcatgacagtaaagtttatcat
tacacaattgaaagggaaattagtggctcttatgccatttcaggaggaaagtcccacagg
agtcctgtagaactcattaactaccactcagatgaagtagatggtcttgtttgcctactc
aaaaaatcatgtaatcgcccaccaggagtggaaccaaaaaccagtcagtttgaagactta
aaagagaatcttatcagggaatatgtcaaacgaacttggaacttacaggggcatgctctt
gagcaagcaattattagtcagaaaccacagctagagaaattgattgcaacaacagcacat
ttgaagatgccctggttccatgggatgatatctcgtgaggaatcagagcaacgggtccat
ctggggacaaagactaatgggaaatttttgatcagggaaagagataacaatggatccttt
gctctctgcctcctcaatgaaggaaaggttttacattatcgcattgataaagacaagaag
ggaaagctctcaatcccagacggaaagaagtttgatactctctgccagctcgtggaacat
tattcctacaaagcagatggccttctaagaataatcactgatccagttccaaatccaaat
ttccacttaacaaatggacaatctgattttggcaacacaccagaacttcctaaacggtca
actaataagtcagttttccctgttcctggccgaagtgctgattctcaattattcaacgac
tacgttccacgaaggaagcgagttcaatgtgcagatgatcaaagggaagctttgcctatg
gacacagaagtctatgaaagtccatatgctgatccagaagaagttaaagctaaaaatgtc
actcttgacagaagtctgctgattctggaagatcaggaacttggttctggtaattttggc
actgtaaaaaaaggcacctatgaaatgaaaaagtaagttattaaattggctgtaaaaatt
ctcaagaatgaaagtaatgatccctctgtaaaagatgaactgctgagagaagcaaatgtt
atgcaacaactggataacccatatattgtccggatgattggtatttgcgaagctgagtcc
tggatgttggtaatggagatggctgaacttggcccgttgaataagtatttgatgaaacac
aaagatgtcacagacaagaacattatagagcttgttcatcaagtttctatgggaatgaaa
tatctggaagaaaacaactttgtgcatagagatctagctgcaagaaatgtgttactagtt
acccaacattatgccaaaatcagtgattttggactttctaaagctcttggctctaatgat
tattacaaggcagaacgttatgggaaatggccagtcaagtggtatgctccagaatgcatg
aacttcttcaaattttcaagcaagagtgatgtctggagttttggtgtgctaatgtgggag
gcgttttcatatggtcaaaagccatacaagggtatgaaaggaggggaagttgctcagatg
cttgaaagaggagacagaatggaatgtcctccaggttgcccgcctgaggtctatgaatta
atgaaactgtgttggacatacaatgttgatgatcggccagcattttcgtcagtggaatta
aggctgcgcaacttctattatgacattgcacaataa

DBGET integrated database retrieval system