KEGG   Anolis carolinensis (green anole): 100554859Help
Entry
100554859         CDS       T01608                                 

Gene name
syk
Definition
spleen tyrosine kinase
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100554859 (syk)
Protein kinases [BR:acs01001]
 Tyrosine protein kinases
  Syk family
   100554859 (syk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 634 aa AA seqDB search
MANAHSISHLPYFFGNITREEAEDYLIQCGLSNGLYLLRQSRNYLGGFALSLVHDSKVYH
YTIEREISGSYAISGGKSHRSPVELINYHSDEVDGLVCLLKKSCNRPPGVEPKTSQFEDL
KENLIREYVKRTWNLQGHALEQAIISQKPQLEKLIATTAHLKMPWFHGMISREESEQRVH
LGTKTNGKFLIRERDNNGSFALCLLNEGKVLHYRIDKDKKGKLSIPDGKKFDTLCQLVEH
YSYKADGLLRIITDPVPNPNFHLTNGQSDFGNTPELPKRSTNKTWSTGGIINRIKSYTFP
RPGSQKSVFPVPGRSADSQLFNDYVPRRKRVQCADDQREALPMDTEVYESPYADPEEVKA
KNVTLDRSLLILEDQELGSGNFGTVKKGTYEMKKGKKVVAVKILKNESNDPSVKDELLRE
ANVMQQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLMKHKDVTDKNIIELVHQVSM
GMKYLEENNFVHRDLAARNVLLVTQHYAKISDFGLSKALGSNDYYKAERYGKWPVKWYAP
ECMNFFKFSSKSDVWSFGVLMWEAFSYGQKPYKGMKGGEVAQMLERGDRMECPPGCPPEV
YELMKLCWTYNVDDRPAFSSVELRLRNFYYDIAQ
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgctcattctattagccacctcccctacttctttggtaacatcactcgtgag
gaagctgaggattatttgattcaatgtggattaagcaatggactgtatctactgcgacag
agccgaaactatcttggaggctttgctttgtccctggttcatgacagtaaagtttatcat
tacacaattgaaagggaaattagtggctcttatgccatttcaggaggaaagtcccacagg
agtcctgtagaactcattaactaccactcagatgaagtagatggtcttgtttgcctactc
aaaaaatcatgtaatcgcccaccaggagtggaaccaaaaaccagtcagtttgaagactta
aaagagaatcttatcagggaatatgtcaaacgaacttggaacttacaggggcatgctctt
gagcaagcaattattagtcagaaaccacagctagagaaattgattgcaacaacagcacat
ttgaagatgccctggttccatgggatgatatctcgtgaggaatcagagcaacgggtccat
ctggggacaaagactaatgggaaatttttgatcagggaaagagataacaatggatccttt
gctctctgcctcctcaatgaaggaaaggttttacattatcgcattgataaagacaagaag
ggaaagctctcaatcccagacggaaagaagtttgatactctctgccagctcgtggaacat
tattcctacaaagcagatggccttctaagaataatcactgatccagttccaaatccaaat
ttccacttaacaaatggacaatctgattttggcaacacaccagaacttcctaaacggtca
actaataagacttggtcaacaggtggaattatcaacagaatcaaatcatacactttccca
aggccaggaagccaaaagtcagttttccctgttcctggccgaagtgctgattctcaatta
ttcaacgactacgttccacgaaggaagcgagttcaatgtgcagatgatcaaagggaagct
ttgcctatggacacagaagtctatgaaagtccatatgctgatccagaagaagttaaagct
aaaaatgtcactcttgacagaagtctgctgattctggaagatcaggaacttggttctggt
aattttggcactgtaaaaaaaggcacctatgaaatgaaaaaggggaaaaaggtagtggct
gtaaaaattctcaagaatgaaagtaatgatccctctgtaaaagatgaactgctgagagaa
gcaaatgttatgcaacaactggataacccatatattgtccggatgattggtatttgcgaa
gctgagtcctggatgttggtaatggagatggctgaacttggcccgttgaataagtatttg
atgaaacacaaagatgtcacagacaagaacattatagagcttgttcatcaagtttctatg
ggaatgaaatatctggaagaaaacaactttgtgcatagagatctagctgcaagaaatgtg
ttactagttacccaacattatgccaaaatcagtgattttggactttctaaagctcttggc
tctaatgattattacaaggcagaacgttatgggaaatggccagtcaagtggtatgctcca
gaatgcatgaacttcttcaaattttcaagcaagagtgatgtctggagttttggtgtgcta
atgtgggaggcgttttcatatggtcaaaagccatacaagggtatgaaaggaggggaagtt
gctcagatgcttgaaagaggagacagaatggaatgtcctccaggttgcccgcctgaggtc
tatgaattaatgaaactgtgttggacatacaatgttgatgatcggccagcattttcgtca
gtggaattaaggctgcgcaacttctattatgacattgcacaataa

DBGET integrated database retrieval system