KEGG   Anolis carolinensis (green anole): 100554861Help
Entry
100554861         CDS       T01608                                 

Definition
lysozyme C, milk isozyme-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
acs  Anolis carolinensis (green anole)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 156 aa AA seqDB search
MPHPSGSAEMKVLAFTLFCLFIAVNEAKVYERCELARKLKNSRLDVSSGYSIADWVCLAY
YESRFNSRAVGPPNRNGSRDYGIFQINSRWWCSNGKGTTANGCRSSCSAFTDDDITNDIA
CAKRIVKDPNGIRAWVAWVKYCQGKNLTRWTQGCRL
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgcctcatccatcaggaagcgcagagatgaaagtgttggccttcaccctcttttgcctc
ttcattgctgtcaatgaagccaaagtatatgagagatgcgaattggctaggaaactgaaa
aactctcggttggatgtttcatctggctacagcattgccgactgggtctgcttggcttac
tatgagagcagattcaacagcagggccgtggggccacccaaccggaatggaagtcgtgac
tatgggatttttcagataaacagccgctggtggtgctccaatggaaaaggcacaactgcc
aatggctgcagaagctcctgcagtgctttcacagatgatgacatcacaaatgatattgca
tgcgctaagagaattgttaaagatcccaacgggataagagcctgggtcgcttgggtgaaa
tactgccaaggaaaaaacctcacccggtggacacaaggctgcagactctaa

DBGET integrated database retrieval system