KEGG   Anolis carolinensis (green anole): 100554910Help
Entry
100554910         CDS       T01608                                 

Definition
replication protein A 32 kDa subunit-like
Orthology
K10739  
replication factor A2
Organism
acs  Anolis carolinensis (green anole)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:acs00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100554910
   03420 Nucleotide excision repair
    100554910
   03430 Mismatch repair
    100554910
   03440 Homologous recombination
    100554910
   03460 Fanconi anemia pathway
    100554910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 268 aa AA seqDB search
MWAGTGGYDSAFGGGGGGYTQSPGGFASPSATQDEKKSRSRSQNIVPCTVSQLLSAEQVD
DTFRVLDVELSQVLIVGIIRQAEKAPTNILYKVDDMSASPMDVRQWVDTDEEGNDNVVVP
PGTYVKVAGHLRSFQNKKSLVAFKIMPLEDMNELTTHLLEVVNAHMILRHAHKFVNMSEP
SSVTGMESTSTYEGNNAMPSGGLTLHQTQILKLIQNCTSSEGISLEDLKNRLPSINLPTL
KKAVEFLSSEGHIYSTIDDEHFKSTDAE
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccgggaccggtggctatgacagtgcatttgggggaggaggaggaggatataca
cagtcacctggaggctttgcatccccttctgcgacacaagatgaaaagaaatcgaggtca
agatcacaaaatattgttccttgtacagtgtctcagttactttcggctgaacaagtggat
gatactttcagggtcctagacgttgaactttcacaggttcttattgtgggcataatcaga
caagctgaaaaagcaccaacaaacattctgtataaagtggatgatatgagtgcatcccca
atggatgtgagacagtgggttgacacagatgaagaaggcaatgacaatgttgtggtgcca
cctggaacatatgtgaaagtggctggccatctgcgatcttttcagaacaaaaagagcctt
gttgctttcaagatcatgccgctggaggacatgaacgaactcactacacacttgcttgaa
gttgtcaatgcacacatgattctcagacacgcccacaagtttgtgaatatgtcagagcca
tcttctgtgacagggatggaaagcacgtcaacctatgaaggaaataatgccatgccatcg
ggcgggctgacgctgcatcagactcagatcctgaaattgattcagaactgcacatcgtca
gaagggataagtctcgaagatctgaagaacaggttgcctagtattaatctaccgacactg
aagaaagctgttgagtttcttagcagcgagggacacatctattccacaattgacgatgaa
cactttaaatctacagatgccgaataa

DBGET integrated database retrieval system