KEGG   Anolis carolinensis (green anole): 100555021Help
Entry
100555021         CDS       T01608                                 

Definition
perforin-1-like
Orthology
K07818  
perforin 1
Organism
acs  Anolis carolinensis (green anole)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 564 aa AA seqDB search
MNPTCAVVVHFLLLFCTRVSPQCRTATEDECQDHQHFIPGHGLAGVGFDITKLERKAAKV
LDMSQWQKADGTCTLCQNPLLDGKPLQRLPLAIADWEAKVACQKNLRSSIQVSGISAVQA
AGSNVDNDWKVELDVQVKPQINVQVALAGSHSKMADFSMEKSSQDQYTFVSHEVSCSYYS
LRIGHRRKLAEHFRHALKTLPLKYNRGTRLEYHQLIGTYGTHWITHLRLGGRMKDVTATR
VCETVLDGVTADEVKDCLSLEASASIGSRNSKTSSSYKMCQELKKKQNFKGSFHNTYNER
HTEVVGGASHVDLLFSNDQSTESFKEWLEGLKSLPDLLSYSLEPIHTLVRKGHPKRESLR
QAVSEYVTERALWRNCTHPCPPETTRSPRDPCSCVCHSNGLTDSMCCSRKRGQGKLTVTI
QRAHNLWGDHTTSTDAYVKVFYQGKQTQTSTIWNNNNPVWKDHFDLGIIQVLGETSKLKI
QVWDEDNRYDDDLLGSCDYTLQAGKPQSTVCYLNHGSLFFQYQLVCGPYLGGPYCLDYAP
QQPKYAGALLQRKGKADPIAPRAP
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgaaccctacctgtgctgttgtggtgcactttctcctcctcttttgcacccgcgtttct
ccacaatgcaggacagccactgaggatgaatgccaggatcaccagcacttcataccaggt
catggcttggctggtgtggggtttgatataacaaagctagagaggaaggcggccaaggtg
ttggatatgagtcaatggcagaaagcagatggaacctgcaccttgtgccagaacccgtta
ctggatggaaaacccctccagaggcttcctctggccattgccgactgggaggccaaagtg
gcgtgccaaaaaaacctccgctcctcaattcaggtctctggcatttctgcggtccaagca
gccggatcaaatgtggacaacgactggaaagtcgagctggatgttcaggtgaagccacag
atcaacgttcaggtggctttggctggctcccattctaagatggccgacttcagcatggag
aaaagttcacaggaccaatatacctttgttagtcacgaagtgtcttgctcatattacagc
ctccgcattggccaccgtcggaagctcgcagagcatttcagacatgccttgaagactctt
cctctcaaatacaaccgtggcacccggctggaataccaccaactgattggcacctacggg
acccattggatcacccaccttcgcttgggaggccggatgaaagatgtgacggcaacacgg
gtgtgtgagacagtgctggacggggtgactgctgatgaggtcaaagactgcctgagcctc
gaggcatctgccagcattggtagccgcaactcaaagacatcttccagctacaaaatgtgt
caagaactgaagaagaagcagaacttcaagggcagtttccacaacacatacaatgagcgg
cacacagaggttgtgggtggggcgagtcacgtggacctgctcttctccaacgaccaaagc
acagagtccttcaaagagtggttagaaggcctcaagtctctgcccgacttgctctcctac
tccctggagcccatccacaccttggttcgaaagggtcaccctaagagggagagcctgcgg
caagcagtgagtgagtatgtgactgagagggctctgtggaggaactgcacccacccttgc
ccaccagaaacaacccgcagccctcgagacccctgctcctgtgtgtgtcacagcaacggt
cttactgactccatgtgctgctcccggaaacgaggtcaaggcaagctgacagtgacaatt
caacgtgcccacaacctgtggggagaccacacaactagtactgatgcctatgttaaggtg
ttctaccaaggaaagcagactcaaacgtccaccatatggaacaacaacaacccagtatgg
aaggaccactttgacttaggcataatccaggtcttgggggagaccagcaagcttaaaata
caggtctgggatgaagacaatcgatacgatgatgatcttttggggtcatgtgattacacc
ttgcaggctgggaaaccacaaagcactgtttgttatcttaaccacgggagtctgtttttc
cagtaccaactggtctgtggtccctacctaggtggaccctattgtttggattatgcccct
cagcagccaaaatatgcaggtgccttattacaacgtaaaggcaaagcagatcccattgca
ccaagagccccctga

DBGET integrated database retrieval system