KEGG   Anolis carolinensis (green anole): 100555087Help
Entry
100555087         CDS       T01608                                 

Definition
lysozyme C II-like
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
acs  Anolis carolinensis (green anole)
Brite
Enzymes [BR:acs01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     100555087
Exosome [BR:acs04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100555087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 148 aa AA seqDB search
MRSLWSLVLLACLLVTGQGEYLSRCEVAQQLQQLGMDGYAGYSLANWVCTAFHESSFNTQ
AMHYDSDGSIDFGIFQINSRYWCQYGNEKSSNACGIQCSELLTNNLAVDAACAKIVVSNS
WNGMGAWVAWRLHCQGQDLSSYVEGCGV
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctctctggtcactcgtgctccttgcctgcctcctggtcacaggacaaggagag
tacctctcacgatgtgaggtggcccagcagctccagcaattggggatggatggctatgct
ggctacagcctggccaattgggtctgcacggcattccacgagagcagcttcaacactcag
gccatgcactatgacagtgatggtagcattgacttcggcatcttccagatcaacagtcgc
tactggtgccagtatggcaacgagaaaagctccaacgcctgcgggattcaatgctctgag
ctgctgacaaacaacctcgctgtagacgcggcttgtgctaagattgtggtctcaaattcg
tggaatggaatgggtgcctgggtggcatggaggttgcattgccaaggccaagacctttct
agttatgttgaaggatgtggtgtgtag

DBGET integrated database retrieval system