KEGG   Anolis carolinensis (green anole): 100555125Help
Entry
100555125         CDS       T01608                                 

Definition
neuropathy target esterase-like
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100555125
Enzymes [BR:acs01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100555125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1353 aa AA seqDB search
MGQSESEPQEEPEDATLTAVLSNIKLFVEDQLQTSMVLGVVIGVGLSVLLVAALILVLIR
RFRLQKVQAQEQPKYRFRKRDKVLFYGRKIMRKVSQSTSSLVDTTISASRPRMKKKLKML
NIAKKILRIKKELPTLQLKEPPPSVLEADLTEFDVANSHLPSEVLYMLKNVRVLGHFEKP
LFLELCKHMTFQQCQQGEYVFRPGQPDTSIYVVQDGKLELYLSEQDGKETLVKEVFPGDS
VHSLLSILDVITGHQRPYRTVSARVAEDSTVLRLPVEAFSAVFEKYPESLVRVVQIIMVR
LQRVTFLALHNYLGLTNELFSHEMQPLRLFPQSSHTSRTSPVRHSKRVISASSIEEAKDS
AGRQQDTFPKEQGDPLKPGLLEPPGAPLLSRCISMPVDISGIQKGPRSDFDMAYERGRIS
VSLQEDSSVFARSVSHESRDRKSVTVEEQPSGIYHYNYCEDDSATGDCPFGPYQGRQTSA
IFEAAKRELVKLMKIEDPSLLNNRVLLHHAKAGTVIARQGDQDVSLHFVLWGCLHVYQRM
IDKAEDVCLFLTQPGEMVGQLAVLTGEPLIFTIKANRDCTFLKISKSDFYEIMREQPSVV
LNVAHTVAARMSPFVRQMDFAIDWMAVEAGRALYRQGDKSDCTYIVLNGRLRSVIQKGNG
KKELVGEYGRGDLIGVVEALTRQVRATTVHAVRDTELAKLPEGTLNNIKRRYPQVVTRLI
HLLSQKILGNLQQLRGPFTGSGLGMASSSELTNPASNLSTVAVLPVCNDVPMAAFTLELK
HALNAIGPTLLLTSDIIRARLGASALDSIHEYRLSGWLAQQEDIHRIVLYQTDYTLTPWT
VRCIRQADCILIVGLGDQEPTLGELEQMLENTAVRALKQLILLHREDGPTPARTVEWLNM
RSWCSGHLHIKCPRRVFSRRSPNKLREMYEKVFEKNADRHSDFSRLARVLTGNTIALVLG
GGGARGCSHIGVIKAMEEAGLPIDLIGGTSIGSFIGALYAEERSAVRTKQRAREWAKSMN
SVFATVLDLTYPITSMFSGSAFNASIHQVFQDKQIEDLWLPYFNVTTDITASAMRVHKDG
SLWRYVRASMTLSGYLPPLCDPKDGNLLMDGGYINNLPADIARNMGAKTVIAIDVGSQDE
TDLCNYGDSLSGWWLLWKRLNPWAEKVKVPDMAEIQSRLAYVSCVRQLEVVKTSSYCEYI
RPPIDRFKTMDFGKFDEIYDVGYQHGRVVFGGWCRGDIIEKMVKDRHSADFYESKRMDVL
MCPSAGFTDLAEIVSRIEPAKSYLSDSYGDEESDYLTEYEEEGMDAVREEEGQELVFAPA
EHNGVFETDEEKSLRHRRGTPGPSPAPVTTPTP
NT seq 4062 nt NT seq  +upstreamnt  +downstreamnt
atggggcagagtgaatcagaaccacaggaggagccagaggatgcaaccctgacagctgtg
ctttccaacatcaagctctttgtggaagatcagcttcagaccagcatggtgttgggtgtt
gtaataggagttgggctttctgtgctccttgttgctgctttgatcctagtgttgatccgg
cggtttcgccttcagaaggttcaggctcaggagcagcccaaataccgatttcgcaagcga
gacaaagtgttgttctatggacggaagatcatgcgcaaggtttctcaatccacatcctca
cttgttgataccactatctccgcttcgcggccacgcatgaagaagaaactcaaaatgcta
aacattgctaagaagatcctgcgcatcaagaaagagctgccaacccttcaactgaaggag
ccacccccctctgtcctggaagcagatctcacagagtttgacgtggccaactcccacctc
ccctctgaggtgctttacatgttgaagaatgtgcgggtgttggggcactttgagaagccc
ttgttcctagagctgtgcaaacacatgactttccaacagtgtcagcaaggcgagtatgtc
tttcgcccaggccaacctgataccagcatctacgtggtccaagatggaaaactggaactc
tacttgtctgaacaggatggaaaagagactctggtgaaggaggtgtttccaggggacagt
gtgcacagtcttctcagtatcctggatgtcattacgggccaccaaagaccatataggaca
gtgtctgcacgggtagctgaggactctacagttttacgtcttcctgtagaagccttctcg
gctgtctttgagaaataccctgagagtcttgtccgggtggtgcagatcatcatggtgcgc
ctgcagagagtcaccttcttggccttgcacaactatcttggcctgacaaatgagcttttt
agccatgagatgcagccactgcggctttttccccagtcaagccacacctcccgcaccagt
cctgtccggcacagcaagcgggtaattagtgcttcctccattgaggaagccaaagatagt
gctggaaggcagcaggacactttccccaaggagcaaggtgacccactgaagccaggctta
ctggagccacctggggccccactgttgagtcgttgcatctccatgccagttgacatctca
ggaattcaaaagggacctcgttcagattttgacatggcctacgagcgaggccgcatctca
gtatctcttcaggaggatagctccgtctttgcccggtcagtgtcccatgagtctcgtgat
cggaaatctgtaacagtagaggagcaaccttctggaatctaccactataactactgtgaa
gatgactcagcaactggagactgcccttttggaccctaccagggccgccagacgagtgcc
atttttgaagctgccaaacgagagctggtcaagctcatgaaaattgaggatccctccttg
ctgaataatcgggtgttgctgcatcatgccaaggctggaacagtgattgctcgtcaagga
gatcaggatgtcagtctgcactttgtgctttggggctgtctacatgtttatcagagaatg
atagacaaagccgaggatgtgtgcctcttcctgactcagccaggcgagatggtgggccag
ttggccgtcctcactggagaaccactcattttcactatcaaggccaaccgtgactgtact
ttcctcaagatttccaagtctgacttctatgagattatgcgggaacagccaagtgtggtc
ctgaatgtagcccatactgtagcagcccgtatgtctccgtttgtgcgccagatggacttt
gcaattgactggatggctgtggaggctggacgtgccctttacaggcagggtgacaagtca
gattgcacctacattgttctgaatgggcggctgcgctctgtgatccagaagggcaatggc
aagaaggagttggtaggagagtatggccgtggagaccttatcggagtggtagaagccctg
acacgccaagtccgagccaccactgtccatgctgtgagggacacagagctggccaaactc
ccagaagggaccctcaataatatcaaacggcgttaccctcaggttgtcacccgccttatc
catctcctgagtcagaagatcctggggaacctccagcagttgcgtggccctttcacaggt
tctggtcttggtatggcctccagctcagagttgaccaatccagctagtaacctctcaact
gtggcagttcttcctgtctgtaatgacgtgcccatggcagctttcacgttggaactaaag
catgccctgaatgccattggtccaacactgttgctcaccagcgacatcatacgagctcgc
cttggggcctcagcattggacagcatccatgaataccgactgtccggttggctggcccag
caagaggacatccatcgcattgttctgtaccagaccgattacaccttgactccctggaca
gtgcgctgcattcgccaagctgactgcattctcattgtgggcctaggggaccaggagccc
acgctgggtgagctagagcagatgctggagaatactgcagtgcgtgctctgaagcaactc
atcctcctgcaccgtgaggacggcccaactcctgcccgcaccgtagagtggctcaacatg
cgtagctggtgttcaggacatttacatatcaagtgcccgcgcagggtcttttcccgacgc
agccccaacaagctgagggagatgtacgagaaagtcttcgagaagaatgccgatcgccat
agtgatttctcccggctggcacgagtccttacaggcaacacaattgccttagttctagga
ggcggtggggccaggggatgttctcacattggtgtgatcaaggctatggaggaagctggg
ctccctattgacctaattggtggcacctccataggatcctttattggtgccctgtatgct
gaggagcggagtgctgtgcgcacaaagcaacgagccagagagtgggccaaaagcatgaat
tcagtgtttgcaacagtgctggacctcacgtatcccatcacctccatgttttctggctct
gccttcaatgccagcattcaccaagttttccaggacaaacagattgaggatctgtggctc
ccatactttaatgtgacaacagacatcacagcatcagccatgcgagtccataaggatggc
tcgctgtggcggtacgtgcgagctagcatgaccctttccgggtacctaccgccactctgc
gaccccaaggacggcaatttactgatggatggcggctacatcaacaacctcccagctgat
attgctcgcaacatgggggccaaaaccgtcattgccattgatgtgggtagccaggatgag
actgatctatgcaactatggggacagtctctcaggctggtggttgctctggaaacgtctc
aatccctgggctgaaaaggttaaggtgcctgatatggcggagatccagtcccggctggcc
tatgtctcatgtgtgcggcagctggaggtggtgaagaccagttcgtactgtgagtacatt
cggccacccatcgatcgcttcaaaaccatggactttggcaagtttgacgaaatctatgat
gtagggtaccagcatggaagagtggtatttggcggttggtgccgtggagacattattgaa
aaaatggttaaggaccggcattcggcagacttctatgagagcaaacgcatggatgtgctg
atgtgtcccagtgcaggtttcacagatctggcagaaattgtgtctcgaattgagcctgcc
aagagctacctgtcagacagctatggagatgaagagtcggactacctaactgagtacgag
gaagaagggatggatgccgtgcgggaggaagaagggcaggaactggtgtttgctccagca
gagcacaatggtgtctttgaaacagatgaggagaagagcctgcgacatcgtcgtgggacc
ccagggccatcgcctgcccctgtcactactcccacaccttga

DBGET integrated database retrieval system