KEGG   Anolis carolinensis (green anole): 100555409Help
Entry
100555409         CDS       T01608                                 

Definition
glycogen [starch] synthase, liver-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
acs  Anolis carolinensis (green anole)
Pathway
Starch and sucrose metabolism
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:acs00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100555409
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100555409
Enzymes [BR:acs01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100555409
Glycosyltransferases [BR:acs01003]
 Polysaccharide
  Storage polysaccharide
   100555409
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 704 aa AA seqDB search
MPLVRSLSVTSLNGLPQWEDEDLPVEDLLLFEVAWEVTNKVGGIYTVIQTKAKITLDEWG
ENYFLIGPYFEHNMKTQVEVCDAPSPAVKKAMDILRENGCQVYFGRWLIEGSPYVVLFDI
GSAAWNLDKWKGEFWDASHIGIPYHDREANDSLIFGSLTAWFLKELTDQLEDKPNVIAHF
HEWQAGPGLILSRFRKIPVATIFTTHATLLGRYLCAASIDFYNHLDQFDIDKEAGERQIY
HRYCMERASVHCAHVFTTVSQITTIEAEHMLKRTADVITPNGLNIKKFSAMHEFQNLHAT
CKAKIQEFVRGHFYGHLDFNLERTLFFFIAGRYEFSNKGADMFLEALSRLNFLLRVHRSD
VTVVVFFIMPANTNNFNVETLKGQAIRKQLWDTAHSVKEKFGKKLYEALLRGEIPDMNKI
IDRDDLTIIKRAIYSTQRQGLPPVTTHNMIDDNTDPILSTIRRIGLFNNRTDRVKVILHP
EFLSSTSPLLPMDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQ
EHVADPAAYGIYIVDRRFRSPDESCNQLTQFLYGFCQQSRRQRIVQRNRTERLSDLLDWR
YLGRYYTHARHLALSRAFPEKFEMEPNAPPKTEGFRYPRPSSVPPSPSVSQHNSPHQSDE
EAEDEDERYDEEEEAERDRQNIKSPFSFNAMPTGKKKQHGEYRN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcctttggtgcgatccctttcggtcacctctctcaatgggctacctcaatgggaagat
gaagacctcccagtggaggatctattactgtttgaagtggcatgggaagtcacgaataaa
gtcggtggcatctacacagtgatccagaccaaagccaaaatcaccttggatgaatggggt
gaaaattatttccttattggcccatattttgaacacaacatgaaaacacaggtggaagtc
tgtgatgcacccagcccagcggtgaaaaaggcaatggatatcttgcgggagaatgggtgt
caggtatattttggcaggtggctcatagaagggagcccatatgtggtgctgttcgatata
ggatcggcagcttggaatctcgacaaatggaaaggggaattctgggatgcaagccacatc
ggaataccttaccacgatcgagaagcaaatgactcactcatctttggatcattaactgcc
tggttcctgaaagagcttaccgatcaattagaagacaaacccaatgttattgcccacttc
cacgaatggcaagcaggacctggcctgatcctctctcgatttaggaagatccctgttgcg
accattttcacaactcacgcaacgctgctggggaggtacctgtgtgcagcaagtatagac
ttctacaaccacctagaccagtttgatatagataaagaagcaggtgaaaggcagatatac
caccgatactgcatggagcgtgcatctgtgcattgtgcccatgtgttcaccacagtctca
cagataactaccatagaagcagaacacatgctgaaaagaacagctgatgtcatcactccg
aatggcttgaacattaagaaattctcagctatgcatgagtttcagaatctgcacgcaacc
tgcaaagctaagatccaagagtttgttcgaggacatttttatggtcatcttgatttcaac
cttgaaaggaccttgtttttcttcattgctgggagatatgagttttctaacaaaggagct
gacatgtttctagaagctttatcaagattaaacttcctattgagggtgcacaggagtgat
gtcacagtagtagtgttcttcataatgccagcaaatactaataatttcaacgtcgaaacc
ttgaaaggccaggcgatccgaaaacaactgtgggacacggcacattctgtgaaagaaaag
tttggcaaaaaactctatgaggcactattaagaggagaaatccccgatatgaacaagatc
atagaccgagatgacctgaccatcattaaaagagccatctattccacccagagacagggc
ctcccaccagtgacaacgcacaacatgattgatgataacactgacccaatcctaagtacc
attagacgtattggccttttcaacaatcgcacagatcgagttaaggtaatactgcatcct
gaattcctttcttcaacaagcccattgttaccaatggattatgacgaattcgtcaggggt
tgtcaccttggggtattcccatcctattatgaaccctggggctacacacctgctgagtgc
acagttatggggattcccagtgtgacgacaaacctttcagggtttggctgcttcatgcaa
gagcatgtggctgacccagctgcttatggtatttacatcgtggataggaggttccgttcc
ccagatgagtcttgtaatcagctgacgcaattcctctatggattctgccagcaatcacgt
cggcaaagaattgtccagaggaaccgaacagaaaggctctcggacttgttggactggaga
tatctaggaaggtattatacgcatgccaggcacttggctcttagtcgagcatttcctgag
aaatttgagatggaacccaatgctccgccaaagactgaaggatttcggtacccaagacct
tcttccgtacccccttcaccctcggtttcccaacacaacagcccccaccaaagcgatgag
gaagcggaagacgaagacgagagatacgatgaggaggaagaggccgaaagggataggcag
aacataaagtcccctttctccttcaacgccatgccaacggggaagaagaagcaacacggg
gaatataggaactga

DBGET integrated database retrieval system