KEGG   Anolis carolinensis (green anole): 100555458Help
Entry
100555458         CDS       T01608                                 

Gene name
cacna2d3
Definition
calcium channel, voltage-dependent, alpha 2/delta subunit 3
Orthology
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
acs  Anolis carolinensis (green anole)
Pathway
MAPK signaling pathway
Cardiac muscle contraction
Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:acs00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100555458 (cacna2d3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100555458 (cacna2d3)
   04261 Adrenergic signaling in cardiomyocytes
    100555458 (cacna2d3)
Ion channels [BR:acs04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100555458 (cacna2d3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 1098 aa AA seqDB search
MGSPGRPWTGFLALERSLLLLLLLFLGAAHSLRRADGAGAEQQIPLSVVKLWASAFGGEI
RSIAAKYSGSQLLQKKYKEYEKDVTIEEIDGLQLVKKLAKIMEEMFHKKSEAVRRLVEAA
EEAHLKHEFDADLQYEYFNAVLINERDEDGNFLELGKEFILEPNDHFNNLPVNVTLSDVQ
VPTNMYNKDPAIVNGVYWSESLNKVFVDNFDHDPSLIWQYFGSAKGFFRQYPGIKWEPDE
NGVIAFDCRNRKWYIQAATSPKDVVILVDVSGSMKGLRLTIAKQTVSSILDTLGDDDFFN
IIAYNEELHYVEPCLNGTLVQADRANKEHFREHLDKLFAKGIGMLDIALVEAFNMLSDFN
HTGQGSICSQAIMLVTDGAVDTYDAVFEKYNWPDRKVRIFTYLIGREAAFADNLKWMACA
NKGFFTQISTLADVQENVMEYLHVLSRPKVIDQEHDVVWTEAYVDSTLPQAQKLADDQGL
VLMTTVAMPVFSKQNETRTSGILLGVVGTDVPVKELLKAIPKYKLGIHGYAFAITNNGYI
LTHPELRPLYEEGKKRRKPNYSSVDLSEVEWEDRDDVLRNAMVNRKTGKFSMEVKKTVDK
GKRVLVMTNDYYYTDIKGTPFSLGVALSRGHGKYFFRGNVTIEEGLHDLEQPDVSLADEW
SYCNTDLHPEHRQMTQLKAIKNYLTGKEPLLPCDKELIQEVLFDAVVSAPIEAYWTSLAL
NKSENSDKGVEVAFLGTRTGLSRVNLFVGPEQLTNQDFLTAGDKENIFNADHFPLWYRRA
AEQIPGSFVYSIPFSTETANKSNVVTASTSIQLLDDRKSPVVAAVGIQMKLEFFQRKFWT
ASRQCTSLDGRCSISCDDDNINCYLIDNNGFILVSEDYTQTGRFFGEVEGAVMNKLLIMG
SFKRITLYDYQAMCRTTKESSDSAHNLLNPYKAFFAAVKWIVTELVLFLVEFNLCNWWHS
DLIAKAQRLKHTLEPCDTEYPAFVSERTIKETTGNIDCDDCFKSFVIQQIQNSNLFMVVV
SNECECESVSPITMEPIEIRYNESLKCERLKSHKIRRRPESCHGFHPEENARECGGVLGL
SAKPTLVVLPLFLAIFSR
NT seq 3297 nt NT seq  +upstreamnt  +downstreamnt
atgggcagccccgggcggccgtggacgggcttcctggccctggaaagaagcctcctcctc
ctcctcttgctcttcctcggggcggcccacagcctccgccgggcggacggggcgggcgcc
gagcagcagatccccttgtccgttgtcaaactctgggcctctgcttttggcggggagatc
cggtccatcgcggcgaaatactccggctcccaacttctgcagaagaaatataaagaatac
gagaaggatgttaccatagaagaaattgatggccttcagcttgtgaagaagctagcgaaa
attatggaggagatgttccataaaaaatctgaagctgtgcggcgccttgttgaagctgca
gaagaggctcatttgaaacatgaatttgatgccgatttacagtatgaatatttcaacgct
gttcttattaatgaacgagatgaagatgggaacttcttagaactgggaaaagaattcatt
ctggagccaaacgaccattttaataatttgcctgtgaatgtcactctgagtgatgtccaa
gtgccaaccaacatgtacaacaaagatcctgctattgtgaatggagtctattggtcagaa
tcattaaacaaagtgtttgttgacaattttgaccatgacccttcccttatatggcaatat
tttggaagtgcaaagggcttttttaggcaatatccaggaataaaatgggagccagatgaa
aatggagtcattgcatttgactgcagaaatcgaaagtggtacattcaggcagccacttct
cccaaagatgttgttattttagtcgatgtcagtgggagcatgaaaggactccgcctgaca
attgcaaagcagaccgtgtcatccattttggacactcttggggatgatgatttttttaac
ataatagcttataatgaagaactccactatgtggaaccatgcctgaatggaactttagtt
caagcagacagagccaacaaagagcacttcagggaacatcttgacaaactgtttgcaaaa
ggaattggaatgctggatattgctttagttgaagccttcaacatgctcagtgatttcaac
cacacaggtcaagggagtatttgcagtcaagctataatgctggttacagatggtgctgtg
gacacctatgatgcagtatttgaaaagtataattggccagataggaaggttcgcattttt
acctacctgataggacgagaagctgcctttgctgataaccttaaatggatggcttgtgcc
aacaaaggttttttcactcagatttcaactctagctgatgtccaggaaaacgttatggaa
tatctccatgtgcttagccgtcccaaagtgattgatcaagagcatgatgtggtatggact
gaagcctatgttgacagcactcttcctcaggctcaaaagcttgctgatgatcagggactg
gttttgatgaccactgttgccatgccagtatttagtaagcaaaatgagactagaacaagt
ggcattctcctgggagttgtaggcacagatgttccagtgaaggaacttttgaaggctatt
ccaaaatacaagttaggtatacatggatatgcattcgcaatcacgaacaatggatatatt
ttgacccatccagaactcagacccctgtatgaagaaggaaaaaagcgaaggaaacccaac
tacagcagtgttgatctttctgaggttgaatgggaagatcgggatgatgtgcttcgaaat
gccatggtgaatcggaaaacaggaaaattctccatggaagtgaagaaaacagtggacaaa
gggaaacgagtgttggtgatgacaaatgactactattatacagacatcaaggggactcct
ttcagtttaggtgtggctctctctcgagggcatggcaaatatttcttcagaggaaatgtg
actattgaagaaggcttgcatgacttggaacagcctgatgtatccttggcagatgaatgg
tcatattgcaacacagacttgcatcctgagcaccgccaaatgactcaactgaaggctatt
aaaaactacctcaccgggaaagagccattgcttccatgtgataaagaactgatacaagaa
gtattgtttgatgcagtagtgagtgcaccaatagaagcttattggaccagccttgcgtta
aacaaatcagaaaattctgacaagggagtagaagttgctttccttggaacccggacaggt
ctttctcgagtcaatttgtttgtaggaccagaacaactaactaatcaagacttcttgacg
gctggagacaaggagaatattttcaatgctgatcattttccgctttggtacagaagagct
gctgaacagatcccaggaagctttgtctactccattccattcagtacagaaacagcaaac
aaaagcaatgtggtgacagcaagtacttctattcagcttctagatgacagaaaatctcca
gtggtagcagctgtaggtatccagatgaaacttgagtttttccagaggaaattctggact
gctagtagacagtgtacatctcttgatggccgatgttccataagctgtgatgatgataat
atcaactgttacctcattgataataatggatttatattagtttcagaagactatacgcag
actggacgcttctttggtgaggttgagggagctgtgatgaacaaattgctaataatgggc
tcctttaaaagaattacactgtatgattaccaagctatgtgtagaacaactaaagaaagt
agtgatagcgcccataacttactgaatccttataaagccttctttgctgcagtaaaatgg
attgtgacagaacttgtcttgtttctggtggaatttaatctatgcaattggtggcactct
gatctaatagcaaaggcccagagattgaaacataccctagagccttgtgacactgaatat
cctgcctttgtttctgaacgcacaatcaaagagactacaggcaatattgattgtgatgac
tgtttcaagtcctttgtcatccagcaaattcaaaacagcaatctcttcatggtagtagta
agtaatgagtgtgagtgtgaatcagtttccccgattaccatggagccaatagaaataagg
tataatgaatccctcaagtgtgaacgcttaaaatctcacaagattagaagacgtccagaa
tcctgtcatggattccatcctgaggagaatgccagagaatgtggtggagttttaggcctg
agtgctaagcctacccttgttgtgcttcctctgtttctggccattttctcaaggtga

DBGET integrated database retrieval system